Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 133 (13 Feb 2019)
Sequence version 2 (05 Oct 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Na(+)/H(+) exchange regulatory cofactor NHE-RF4

Gene

PDZD3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a regulatory protein that associates with GUCY2C and negatively modulates its heat-stable enterotoxin-mediated activation (PubMed:11950846). Stimulates SLC9A3 activity in the presence of elevated calcium ions (PubMed:19088451).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • guanylate cyclase inhibitor activity Source: UniProtKB
  • ion channel inhibitor activity Source: UniProtKB
  • protein C-terminus binding Source: UniProtKB
  • ubiquitin-specific protease binding Source: UniProtKB

GO - Biological processi

  • ion transport Source: UniProtKB
  • negative regulation of cGMP-mediated signaling Source: UniProtKB
  • receptor guanylyl cyclase signaling pathway Source: UniProtKB
  • response to toxic substance Source: UniProtKB
  • water transport Source: UniProtKB

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8942233 Intestinal infectious diseases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Na(+)/H(+) exchange regulatory cofactor NHE-RF4
Short name:
NHERF-4
Alternative name(s):
Intestinal and kidney-enriched PDZ protein
Natrium-phosphate cotransporter IIa C-terminal-associated protein 2
Short name:
Na/Pi cotransporter C-terminal-associated protein 2
Short name:
NaPi-Cap2
PDZ domain-containing protein 2
PDZ domain-containing protein 3
Sodium-hydrogen exchanger regulatory factor 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PDZD3
Synonyms:IKEPP, NHERF4, PDZK2
ORF Names:DLNB27
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000172367.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19891 PDZD3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607146 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86UT5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79849

Open Targets

More...
OpenTargetsi
ENSG00000172367

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134911718

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PDZD3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
308153467

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000582921 – 571Na(+)/H(+) exchange regulatory cofactor NHE-RF4Add BLAST571

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86UT5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q86UT5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86UT5

PeptideAtlas

More...
PeptideAtlasi
Q86UT5

PRoteomics IDEntifications database

More...
PRIDEi
Q86UT5

ProteomicsDB human proteome resource

More...
ProteomicsDBi
69882
69883 [Q86UT5-2]
69884 [Q86UT5-3]
69885 [Q86UT5-4]
69886 [Q86UT5-5]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q86UT5-4 [Q86UT5-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86UT5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86UT5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in kidney and the gastrointestinal tract. Not detected in brain, heart, skeletal muscle or cells of hematopoietic origin.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000172367 Expressed in 74 organ(s), highest expression level in mucosa of transverse colon

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q86UT5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86UT5 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the C-terminal region of GUCY2C (PubMed:11950846). Interacts with the C-terminal region SLC9A3 and the interactions decrease in response to elevated calcium ion levels (PubMed:19088451). Interacts with the C-terminal region of SLC34A1 (By similarity). Interacts with USP2 isoform 4 (PubMed:26756164).By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122940, 8 interactors

Protein interaction database and analysis system

More...
IntActi
Q86UT5, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000347742

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1571
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2V90X-ray2.00A/B/C/D/E/F326-415[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q86UT5

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86UT5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q86UT5

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini115 – 196PDZ 1PROSITE-ProRule annotationAdd BLAST82
Domaini223 – 301PDZ 2PROSITE-ProRule annotationAdd BLAST79
Domaini329 – 412PDZ 3PROSITE-ProRule annotationAdd BLAST84
Domaini467 – 548PDZ 4PROSITE-ProRule annotationAdd BLAST82

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410ITA7 Eukaryota
ENOG410XURS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153540

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000048712

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG080760

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86UT5

Identification of Orthologs from Complete Genome Data

More...
OMAi
CHVVKDE

Database of Orthologous Groups

More...
OrthoDBi
880632at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86UT5

TreeFam database of animal gene trees

More...
TreeFami
TF350449

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031200 NHERF-4
IPR001478 PDZ
IPR036034 PDZ_sf

The PANTHER Classification System

More...
PANTHERi
PTHR14191:SF20 PTHR14191:SF20, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00595 PDZ, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50106 PDZ, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q86UT5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVTPSPPGNH SLSLEAPRLH TASDLLGNHS LGLPLITALV GSRDRRGRVF
60 70 80 90 100
SPVPVPLPTN PTTQHPTRQK LPSTLSGHRV CQAHGEPVLG LCPLLPLFCC
110 120 130 140 150
PPHPPDPWSL ERPRFCLLSK EEGKSFGFHL QQELGRAGHV VCRVDPGTSA
160 170 180 190 200
QRQGLQEGDR ILAVNNDVVE HEDYAVVVRR IRASSPRVLL TVLARHAHDV
210 220 230 240 250
ARAQLGEDAH LCPTLGPGVR PRLCHIVKDE GGFGFSVTHG NQGPFWLVLS
260 270 280 290 300
TGGAAERAGV PPGARLLEVN GVSVEKFTHN QLTRKLWQSG QQVTLLVAGP
310 320 330 340 350
EVEEQCRQLG LPLAAPLAEG WALPTKPRCL HLEKGPQGFG FLLREEKGLD
360 370 380 390 400
GRPGQFLWEV DPGLPAKKAG MQAGDRLVAV AGESVEGLGH EETVSRIQGQ
410 420 430 440 450
GSCVSLTVVD PEADRFFSMV RLSPLLFLEN TEAPASPRGS SSASLVETED
460 470 480 490 500
PSLEDTSVPS VPLGSRQCFL YPGPGGSYGF RLSCVASGPR LFISQVTPGG
510 520 530 540 550
SAARAGLQVG DVILEVNGYP VGGQNDLERL QQLPEAEPPL CLKLAARSLR
560 570
GLEAWIPPGA AEDWALASDL L
Length:571
Mass (Da):61,032
Last modified:October 5, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB56CDC91348EE592
GO
Isoform 21 Publication (identifier: Q86UT5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.
     67-105: TRQKLPSTLS...PLFCCPPHPP → MEKAADLQDT...LSLAEDHDPY

Show »
Length:505
Mass (Da):54,217
Checksum:iACDAE2A896787C5D
GO
Isoform 3Curated (identifier: Q86UT5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.
     67-105: TRQKLPSTLS...PLFCCPPHPP → MEKAADLQDT...LSLAEDHDPY
     272-285: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:491
Mass (Da):52,548
Checksum:i46F3C5D292274D56
GO
Isoform 4Curated (identifier: Q86UT5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     355-386: QFLWEVDPGLPAKKAGMQAGDRLVAVAGESVE → EWEPWGRWGKVGLGVGTQAYIHLSVHRRGVPV
     387-571: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:386
Mass (Da):41,888
Checksum:iBE18E918ECD4009D
GO
Isoform 5Curated (identifier: Q86UT5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.
     67-105: TRQKLPSTLS...PLFCCPPHPP → MEKAADLQDT...LSLAEDHDPY
     287-571: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:220
Mass (Da):24,105
Checksum:i87EC9259F8262E0A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PPZ1E9PPZ1_HUMAN
Na(+)/H(+) exchange regulatory cofa...
PDZD3
492Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRB0E9PRB0_HUMAN
Na(+)/H(+) exchange regulatory cofa...
PDZD3
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti112R → P in BAB15474 (PubMed:14702039).Curated1
Sequence conflicti125S → G in BAC03780 (PubMed:14702039).Curated1
Sequence conflicti286L → V in BAB15474 (PubMed:14702039).Curated1
Sequence conflicti438R → Q in BAC76050 (Ref. 2) Curated1
Sequence conflicti438R → Q in AAH29042 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0517861 – 66Missing in isoform 2, isoform 3 and isoform 5. 3 PublicationsAdd BLAST66
Alternative sequenceiVSP_05178767 – 105TRQKL…PPHPP → MEKAADLQDTASLTLKFKFN PKLGIDNPVLSLAEDHDPY in isoform 2, isoform 3 and isoform 5. 3 PublicationsAdd BLAST39
Alternative sequenceiVSP_051788272 – 285Missing in isoform 3. 2 PublicationsAdd BLAST14
Alternative sequenceiVSP_051789287 – 571Missing in isoform 5. 2 PublicationsAdd BLAST285
Alternative sequenceiVSP_051790355 – 386QFLWE…GESVE → EWEPWGRWGKVGLGVGTQAY IHLSVHRRGVPV in isoform 4. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_051791387 – 571Missing in isoform 4. 2 PublicationsAdd BLAST185

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY047359 mRNA Translation: AAL10686.1
AB094096 mRNA Translation: BAC76050.1
AK026409 mRNA Translation: BAB15474.1
AK091966 mRNA Translation: BAC03780.1
AP002956 Genomic DNA No translation available.
BC029042 mRNA Translation: AAH29042.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS53719.1 [Q86UT5-2]
CCDS8417.1 [Q86UT5-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001161940.1, NM_001168468.1 [Q86UT5-2]
NP_079067.3, NM_024791.3 [Q86UT5-3]
XP_011541302.1, XM_011543000.2 [Q86UT5-1]
XP_011541303.1, XM_011543001.2 [Q86UT5-1]
XP_011541304.1, XM_011543002.2 [Q86UT5-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.374726

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000322712; ENSP00000327107; ENSG00000172367 [Q86UT5-3]
ENST00000355547; ENSP00000347742; ENSG00000172367 [Q86UT5-2]
ENST00000531114; ENSP00000431164; ENSG00000172367 [Q86UT5-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79849

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79849

UCSC genome browser

More...
UCSCi
uc001pvy.4 human [Q86UT5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY047359 mRNA Translation: AAL10686.1
AB094096 mRNA Translation: BAC76050.1
AK026409 mRNA Translation: BAB15474.1
AK091966 mRNA Translation: BAC03780.1
AP002956 Genomic DNA No translation available.
BC029042 mRNA Translation: AAH29042.1
CCDSiCCDS53719.1 [Q86UT5-2]
CCDS8417.1 [Q86UT5-3]
RefSeqiNP_001161940.1, NM_001168468.1 [Q86UT5-2]
NP_079067.3, NM_024791.3 [Q86UT5-3]
XP_011541302.1, XM_011543000.2 [Q86UT5-1]
XP_011541303.1, XM_011543001.2 [Q86UT5-1]
XP_011541304.1, XM_011543002.2 [Q86UT5-1]
UniGeneiHs.374726

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2V90X-ray2.00A/B/C/D/E/F326-415[»]
ProteinModelPortaliQ86UT5
SMRiQ86UT5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122940, 8 interactors
IntActiQ86UT5, 6 interactors
STRINGi9606.ENSP00000347742

PTM databases

iPTMnetiQ86UT5
PhosphoSitePlusiQ86UT5

Polymorphism and mutation databases

BioMutaiPDZD3
DMDMi308153467

Proteomic databases

jPOSTiQ86UT5
MaxQBiQ86UT5
PaxDbiQ86UT5
PeptideAtlasiQ86UT5
PRIDEiQ86UT5
ProteomicsDBi69882
69883 [Q86UT5-2]
69884 [Q86UT5-3]
69885 [Q86UT5-4]
69886 [Q86UT5-5]
TopDownProteomicsiQ86UT5-4 [Q86UT5-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000322712; ENSP00000327107; ENSG00000172367 [Q86UT5-3]
ENST00000355547; ENSP00000347742; ENSG00000172367 [Q86UT5-2]
ENST00000531114; ENSP00000431164; ENSG00000172367 [Q86UT5-1]
GeneIDi79849
KEGGihsa:79849
UCSCiuc001pvy.4 human [Q86UT5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79849
DisGeNETi79849
EuPathDBiHostDB:ENSG00000172367.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PDZD3

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0201614
HGNCiHGNC:19891 PDZD3
MIMi607146 gene
neXtProtiNX_Q86UT5
OpenTargetsiENSG00000172367
PharmGKBiPA134911718

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410ITA7 Eukaryota
ENOG410XURS LUCA
GeneTreeiENSGT00940000153540
HOGENOMiHOG000048712
HOVERGENiHBG080760
InParanoidiQ86UT5
OMAiCHVVKDE
OrthoDBi880632at2759
PhylomeDBiQ86UT5
TreeFamiTF350449

Enzyme and pathway databases

ReactomeiR-HSA-8942233 Intestinal infectious diseases

Miscellaneous databases

EvolutionaryTraceiQ86UT5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79849

Protein Ontology

More...
PROi
PR:Q86UT5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000172367 Expressed in 74 organ(s), highest expression level in mucosa of transverse colon
ExpressionAtlasiQ86UT5 baseline and differential
GenevisibleiQ86UT5 HS

Family and domain databases

InterProiView protein in InterPro
IPR031200 NHERF-4
IPR001478 PDZ
IPR036034 PDZ_sf
PANTHERiPTHR14191:SF20 PTHR14191:SF20, 1 hit
PfamiView protein in Pfam
PF00595 PDZ, 3 hits
SMARTiView protein in SMART
SM00228 PDZ, 4 hits
SUPFAMiSSF50156 SSF50156, 4 hits
PROSITEiView protein in PROSITE
PS50106 PDZ, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNHRF4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86UT5
Secondary accession number(s): Q8N6R4
, Q8NAW7, Q8NEX7, Q9H5Z3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: October 5, 2010
Last modified: February 13, 2019
This is version 133 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again