Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q86UK7 (ZN598_HUMAN)

Entry version 144 (02 Jun 2021)
Sequence version 1 (01 Jun 2003)
Previous versions | rss
Add a publicationFeedback
Protein

E3 ubiquitin-protein ligase ZNF598

Gene

ZNF598

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase that plays a key role in the ribosome quality control (RQC), a pathway that takes place when a ribosome has stalled during translation (PubMed:28065601, PubMed:28132843).

Required for ribosomes to terminally stall during translation of poly(A) sequences by mediating monoubiquitination of 40S ribosomal protein RPS10/eS10, RPS20/uS10 and RPS3/uS3 (PubMed:28065601, PubMed:28132843).

Stalling precludes synthesis of a long poly-lysine tail and initiates the RQC pathway to degrade the potentially detrimental aberrant nascent polypeptide (PubMed:28065601, PubMed:28132843).

Also acts as a component of the 4EHP-GYF2 complex, a multiprotein complex that acts as a repressor of translation initiation (PubMed:22751931).

3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.2 Publications EC:2.3.2.27

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri29 – 69RING-typePROSITE-ProRule annotationAdd BLAST41
Zinc fingeri187 – 210C2H2-typePROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processTranslation regulation, Ubl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q86UK7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase ZNF598Curated (EC:2.3.2.272 Publications)
Alternative name(s):
Zinc finger protein 598Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF598Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:28079, ZNF598

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		617508, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q86UK7

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000167962.12

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi29C → A: Abolishes E3 ubiquitin-protein ligase activity, leading to enhanced readthrough on the poly(A)-stall sequences. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		90850

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134944505

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q86UK7, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ZNF598

Domain mapping of disease mutations (DMDM)

More...DMDMi		74727495

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002505681 – 904E3 ubiquitin-protein ligase ZNF598Add BLAST904

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei306PhosphotyrosineCombined sources1
Modified residuei437PhosphoserineCombined sources1
Isoform 2 (identifier: Q86UK7-2)
Modified residuei428PhosphoserineCombined sources1
Isoform 3 (identifier: Q86UK7-3)
Modified residuei431PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q86UK7

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q86UK7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q86UK7

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q86UK7

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q86UK7

PeptideAtlas

More...PeptideAtlasi		Q86UK7

PRoteomics IDEntifications database

More...PRIDEi		Q86UK7

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		69826 [Q86UK7-1]
69827 [Q86UK7-2]
69828 [Q86UK7-3]
69829 [Q86UK7-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q86UK7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q86UK7

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q86UK7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000167962, Expressed in adenohypophysis and 167 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q86UK7, HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the 4EHP-GYF2 complex, at least composed of EIF4E2, GIGYF2 and ZNF598 (PubMed:22751931).

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		124771, 399 interactors

Protein interaction database and analysis system

More...IntActi		Q86UK7, 27 interactors

Molecular INTeraction database

More...MINTi		Q86UK7

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000411409

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q86UK7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q86UK7

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni312 – 469DisorderedSequence analysisAdd BLAST158
Regioni490 – 656DisorderedSequence analysisAdd BLAST167

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi332 – 347Basic and acidic residuesSequence analysisAdd BLAST16
Compositional biasi359 – 392Basic and acidic residuesSequence analysisAdd BLAST34
Compositional biasi399 – 415Polar residuesSequence analysisAdd BLAST17
Compositional biasi446 – 461Polar residuesSequence analysisAdd BLAST16
Compositional biasi495 – 533Polar residuesSequence analysisAdd BLAST39
Compositional biasi565 – 582Polar residuesSequence analysisAdd BLAST18
Compositional biasi600 – 614Pro residuesSequence analysisAdd BLAST15

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ZNF598 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri29 – 69RING-typePROSITE-ProRule annotationAdd BLAST41
Zinc fingeri187 – 210C2H2-typePROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2231, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_015828_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q86UK7

Database of Orthologous Groups

More...OrthoDBi		1003372at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q86UK7

TreeFam database of animal gene trees

More...TreeFami		TF316196

Family and domain databases

Conserved Domains Database

More...CDDi		cd16615, RING-HC_ZNF598, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR041888, RING-HC_ZNF598/Hel2
IPR044288, ZNF598/Hel2
IPR013087, Znf_C2H2_type
IPR001841, Znf_RING

The PANTHER Classification System

More...PANTHERi		PTHR22938, PTHR22938, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00355, ZnF_C2H2, 5 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50089, ZF_RING_2, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86UK7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAGGAEGR RAALEAAAAA APERGGGSCV LCCGDLEATA LGRCDHPVCY 
        60         70         80         90        100
RCSTKMRVLC EQRYCAVCRE ELRQVVFGKK LPAFATIPIH QLQHEKKYDI 
       110        120        130        140        150
YFADGKVYAL YRQLLQHECP RCPELPPFSL FGDLEQHMRR QHELFCCRLC 
       160        170        180        190        200
LQHLQIFTYE RKWYSRKDLA RHRMQGDPDD TSHRGHPLCK FCDERYLDND 
       210        220        230        240        250
ELLKHLRRDH YFCHFCDSDG AQDYYSDYAY LREHFREKHF LCEEGRCSTE 
       260        270        280        290        300
QFTHAFRTEI DLKAHRTACH SRSRAEARQN RHIDLQFSYA PRHSRRNEGV 
       310        320        330        340        350
VGGEDYEEVD RYSRQGRVAR AGTRGAQQSR RGSWRYKREE EDREVAAAVR 
       360        370        380        390        400
ASVAAQQQEE ARRSEDQEEG GRPKKEEAAA RGPEDPRGPR RSPRTQGEGP 
       410        420        430        440        450
GPKETSTNGP VSQEAFSVTG PAAPGCVGVP GALPPPSPKL KDEDFPSLSA 
       460        470        480        490        500
STSSSCSTAA TPGPVGLALP YAIPARGRSA FQEEDFPALV SSVPKPGTAP 
       510        520        530        540        550
TSLVSAWNSS SSSKKVAQPP LSAQATGSGQ PTRKAGKGSR GGRKGGPPFT 
       560        570        580        590        600
QEEEEDGGPA LQELLSTRPT GSVSSTLGLA SIQPSKVGKK KKVGSEKPGT 
       610        620        630        640        650
TLPQPPPATC PPGALQAPEA PASRAEGPVA VVVNGHTEGP APARSAPKEP 
       660        670        680        690        700
PGLPRPLGSF PCPTPQEDFP ALGGPCPPRM PPPPGFSAVV LLKGTPPPPP 
       710        720        730        740        750
PGLVPPISKP PPGFSGLLPS PHPACVPSPA TTTTTKAPRL LPAPRAYLVP 
       760        770        780        790        800
ENFRERNLQL IQSIRDFLQS DEARFSEFKS HSGEFRQGLI SAAQYYKSCR 
       810        820        830        840        850
DLLGENFQKV FNELLVLLPD TAKQQELLSA HTDFCNREKP LSTKSKKNKK 
       860        870        880        890        900
SAWQATTQQA GLDCRVCPTC QQVLAHGDAS SHQALHAARD DDFPSLQAIA 

RIIT
Length:904
Mass (Da):98,637
Last modified:June 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i492F67EE4E334743
GO
Isoform 2 (identifier: Q86UK7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     335-337: Missing.
     424-429: Missing.
     551-551: Q → QE

Show »
Length:896
Mass (Da):97,806
Checksum:i0524BC8755C1B28D
GO
Isoform 3 (identifier: Q86UK7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     424-429: Missing.

Show »
Length:898
Mass (Da):98,124
Checksum:i1C24E53E1A3573CF
GO
Isoform 4 (identifier: Q86UK7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-397: Missing.
     398-431: EGPGPKETSTNGPVSQEAFSVTGPAAPGCVGVPG → MVGGCGQPQVGAGRAGMEPRGLIAVDQLCFPAPS
     551-551: Q → QE
     738-904: Missing.

Show »
Length:341
Mass (Da):34,010
Checksum:iABB2FDC981BB27EC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BPG6H3BPG6_HUMAN
RING-type E3 ubiquitin transferase
ZNF598
904Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BQQ2H3BQQ2_HUMAN
E3 ubiquitin-protein ligase ZNF598
ZNF598
849Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BR87H3BR87_HUMAN
E3 ubiquitin-protein ligase ZNF598
ZNF598
203Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BPF3H3BPF3_HUMAN
E3 ubiquitin-protein ligase ZNF598
ZNF598
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB15777 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034470453S → Y2 PublicationsCorresponds to variant dbSNP:rs11556528Ensembl.1
Natural variantiVAR_059818608A → T2 PublicationsCorresponds to variant dbSNP:rs11248905Ensembl.1
Natural variantiVAR_052147637T → M2 PublicationsCorresponds to variant dbSNP:rs2286469Ensembl.1
Natural variantiVAR_034471725C → S1 PublicationCorresponds to variant dbSNP:rs2286468Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0206601 – 397Missing in isoform 4. 1 PublicationAdd BLAST397
Alternative sequenceiVSP_020661335 – 337Missing in isoform 2. 1 Publication3
Alternative sequenceiVSP_020662398 – 431EGPGP…VGVPG → MVGGCGQPQVGAGRAGMEPR GLIAVDQLCFPAPS in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_020663424 – 429Missing in isoform 2 and isoform 3. 2 Publications6
Alternative sequenceiVSP_020664551Q → QE in isoform 2 and isoform 4. 2 Publications1
Alternative sequenceiVSP_020665738 – 904Missing in isoform 4. 1 PublicationAdd BLAST167

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK024487 mRNA Translation: BAB15777.1 Different initiation.
BC010990 mRNA Translation: AAH10990.2
BC041015 mRNA Translation: AAH41015.1
BC050477 mRNA Translation: AAH50477.1
AL834428 mRNA Translation: CAD39089.1

NCBI Reference Sequences

More...RefSeqi		NP_835461.2, NM_178167.3

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...GeneIDi		90850

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:90850

UCSC genome browser

More...UCSCi		uc002cof.3, human [Q86UK7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024487 mRNA Translation: BAB15777.1 Different initiation.
BC010990 mRNA Translation: AAH10990.2
BC041015 mRNA Translation: AAH41015.1
BC050477 mRNA Translation: AAH50477.1
AL834428 mRNA Translation: CAD39089.1
RefSeqiNP_835461.2, NM_178167.3

3D structure databases

SMRiQ86UK7
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124771, 399 interactors
IntActiQ86UK7, 27 interactors
MINTiQ86UK7
STRINGi9606.ENSP00000411409

PTM databases

iPTMnetiQ86UK7
PhosphoSitePlusiQ86UK7
SwissPalmiQ86UK7

Genetic variation databases

BioMutaiZNF598
DMDMi74727495

Proteomic databases

EPDiQ86UK7
jPOSTiQ86UK7
MassIVEiQ86UK7
MaxQBiQ86UK7
PaxDbiQ86UK7
PeptideAtlasiQ86UK7
PRIDEiQ86UK7
ProteomicsDBi69826 [Q86UK7-1]
69827 [Q86UK7-2]
69828 [Q86UK7-3]
69829 [Q86UK7-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		90850

Genome annotation databases

GeneIDi90850
KEGGihsa:90850
UCSCiuc002cof.3, human [Q86UK7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		90850
DisGeNETi90850

GeneCards: human genes, protein and diseases

More...GeneCardsi		ZNF598
HGNCiHGNC:28079, ZNF598
MIMi617508, gene
neXtProtiNX_Q86UK7
PharmGKBiPA134944505
VEuPathDBiHostDB:ENSG00000167962.12

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2231, Eukaryota
HOGENOMiCLU_015828_0_0_1
InParanoidiQ86UK7
OrthoDBi1003372at2759
PhylomeDBiQ86UK7
TreeFamiTF316196

Enzyme and pathway databases

PathwayCommonsiQ86UK7

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		90850, 23 hits in 219 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ZNF598, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		90850
PharosiQ86UK7, Tbio

Protein Ontology

More...PROi		PR:Q86UK7
RNActiQ86UK7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000167962, Expressed in adenohypophysis and 167 other tissues
GenevisibleiQ86UK7, HS

Family and domain databases

CDDicd16615, RING-HC_ZNF598, 1 hit
InterProiView protein in InterPro
IPR041888, RING-HC_ZNF598/Hel2
IPR044288, ZNF598/Hel2
IPR013087, Znf_C2H2_type
IPR001841, Znf_RING
PANTHERiPTHR22938, PTHR22938, 1 hit
SMARTiView protein in SMART
SM00355, ZnF_C2H2, 5 hits
PROSITEiView protein in PROSITE
PS50089, ZF_RING_2, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN598_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86UK7
Secondary accession number(s): Q8IW49
, Q8N3D9, Q96FG3, Q9H7J3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: June 1, 2003
Last modified: June 2, 2021
This is version 144 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again