Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

39S ribosomal protein L52, mitochondrial

Gene

MRPL52

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionRibonucleoprotein, Ribosomal protein

Enzyme and pathway databases

ReactomeiR-HSA-5368286 Mitochondrial translation initiation
R-HSA-5389840 Mitochondrial translation elongation
R-HSA-5419276 Mitochondrial translation termination

Names & Taxonomyi

Protein namesi
Recommended name:
39S ribosomal protein L52, mitochondrial
Short name:
L52mt
Short name:
MRP-L52
Alternative name(s):
Mitochondrial large ribosomal subunit protein mL521 Publication
Gene namesi
Name:MRPL52
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000172590.18
HGNCiHGNC:16655 MRPL52
MIMi611856 gene
neXtProtiNX_Q86TS9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000172590
PharmGKBiPA30985

Polymorphism and mutation databases

BioMutaiMRPL52
DMDMi124053357

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 23MitochondrionSequence analysisAdd BLAST23
ChainiPRO_000027309324 – 12339S ribosomal protein L52, mitochondrialAdd BLAST100

Proteomic databases

EPDiQ86TS9
MaxQBiQ86TS9
PaxDbiQ86TS9
PeptideAtlasiQ86TS9
PRIDEiQ86TS9
ProteomicsDBi69730
TopDownProteomicsiQ86TS9-1 [Q86TS9-1]
Q86TS9-3 [Q86TS9-3]

PTM databases

iPTMnetiQ86TS9
PhosphoSitePlusiQ86TS9

Expressioni

Gene expression databases

BgeeiENSG00000172590 Expressed in 202 organ(s), highest expression level in left adrenal gland
CleanExiHS_MRPL52
ExpressionAtlasiQ86TS9 baseline and differential
GenevisibleiQ86TS9 HS

Organism-specific databases

HPAiHPA012319

Interactioni

Subunit structurei

Component of the mitochondrial large ribosomal subunit (mt-LSU) (PubMed:28892042, PubMed:25278503). Mature mammalian 55S mitochondrial ribosomes consist of a small (28S) and a large (39S) subunit. The 28S small subunit contains a 12S ribosomal RNA (12S mt-rRNA) and 30 different proteins. The 39S large subunit contains a 16S rRNA (16S mt-rRNA), a copy of mitochondrial valine transfer RNA (mt-tRNA(Val)), which plays an integral structural role, and 52 different proteins. mL52 connects the central protuberance to the body of the ribosome.2 Publications

Protein-protein interaction databases

BioGridi125788, 64 interactors
CORUMiQ86TS9
IntActiQ86TS9, 6 interactors
STRINGi9606.ENSP00000347277

Structurei

Secondary structure

1123
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ86TS9
SMRiQ86TS9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiENOG410J2WG Eukaryota
ENOG4111XV4 LUCA
GeneTreeiENSGT00390000005763
HOGENOMiHOG000293349
HOVERGENiHBG093902
InParanoidiQ86TS9
KOiK17433
OMAiIDQKWRA
OrthoDBiEOG091G0YE9
PhylomeDBiQ86TS9
TreeFamiTF323872

Family and domain databases

InterProiView protein in InterPro
IPR034596 MRPL52
PANTHERiPTHR34090 PTHR34090, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86TS9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAALGTVLFT GVRRLHCSVA AWAGGQWRLQ QGLAANPSGY GPLTELPDWS
60 70 80 90 100
YADGRPAPPM KGQLRRKAER ETFARRVVLL SQEMDAGLQA WQLRQQKLQE
110 120
EQRKQENALK PKGASLKSPL PSQ
Length:123
Mass (Da):13,664
Last modified:January 23, 2007 - v2
Checksum:iA67803930E27E4EE
GO
Isoform 2 (identifier: Q86TS9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: Missing.

Note: No experimental confirmation available.
Show »
Length:64
Mass (Da):7,445
Checksum:i0BD9266F245EDB32
GO
Isoform 3 (identifier: Q86TS9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     10-11: TG → S

Show »
Length:122
Mass (Da):13,593
Checksum:i3EF83F97831296C2
GO
Isoform 4 (identifier: Q86TS9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-87: DGRPAPPMKGQLRRKAERETFARRVVLLSQEMDAG → ETSCTAVTGNGRWITSMAAQAAEVAGRTKEAGKCS
     88-123: Missing.

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:87
Mass (Da):9,072
Checksum:i284DA893B5DDB588
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G5E9P5G5E9P5_HUMAN
39S ribosomal protein L52, mitochon...
MRPL52
110Annotation score:
G3V4J1G3V4J1_HUMAN
39S ribosomal protein L52, mitochon...
MRPL52
72Annotation score:
G3V3U6G3V3U6_HUMAN
39S ribosomal protein L52, mitochon...
MRPL52
51Annotation score:
A6NLB9A6NLB9_HUMAN
39S ribosomal protein L52, mitochon...
MRPL52
52Annotation score:
G3V4H9G3V4H9_HUMAN
39S ribosomal protein L52, mitochon...
MRPL52
52Annotation score:

Sequence cautioni

The sequence CAD66556 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti49W → C in AAH68070 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0300805G → V. Corresponds to variant dbSNP:rs1135641Ensembl.1
Natural variantiVAR_03008119V → A2 PublicationsCorresponds to variant dbSNP:rs4982685Ensembl.1
Natural variantiVAR_052044104K → R. Corresponds to variant dbSNP:rs11538931Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0445601 – 59Missing in isoform 2. 1 PublicationAdd BLAST59
Alternative sequenceiVSP_04524210 – 11TG → S in isoform 3. 1 Publication2
Alternative sequenceiVSP_05409453 – 87DGRPA…EMDAG → ETSCTAVTGNGRWITSMAAQ AAEVAGRTKEAGKCS in isoform 4. CuratedAdd BLAST35
Alternative sequenceiVSP_05409588 – 123Missing in isoform 4. CuratedAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DW429620 mRNA No translation available.
BX248749 mRNA Translation: CAD66556.1 Different initiation.
AL135998 Genomic DNA No translation available.
CH471078 Genomic DNA Translation: EAW66238.1
CH471078 Genomic DNA Translation: EAW66240.1
CH471078 Genomic DNA Translation: EAW66241.1
CH471078 Genomic DNA Translation: EAW66242.1
CH471078 Genomic DNA Translation: EAW66244.1
BC068070 mRNA Translation: AAH68070.1
BU600884 mRNA No translation available.
CCDSiCCDS41917.1 [Q86TS9-1]
CCDS41918.1 [Q86TS9-2]
CCDS9575.1 [Q86TS9-3]
CCDS9576.1 [Q86TS9-4]
RefSeqiNP_848026.1, NM_178336.2 [Q86TS9-1]
NP_851313.1, NM_180982.2 [Q86TS9-3]
NP_851821.1, NM_181304.2 [Q86TS9-2]
NP_851822.1, NM_181305.2 [Q86TS9-2]
NP_851823.1, NM_181306.2 [Q86TS9-2]
NP_851824.1, NM_181307.2 [Q86TS9-4]
XP_005267385.1, XM_005267328.3 [Q86TS9-2]
UniGeneiHs.355935

Genome annotation databases

EnsembliENST00000355151; ENSP00000347277; ENSG00000172590 [Q86TS9-1]
ENST00000397496; ENSP00000380633; ENSG00000172590 [Q86TS9-3]
ENST00000397505; ENSP00000380642; ENSG00000172590 [Q86TS9-4]
ENST00000553711; ENSP00000451303; ENSG00000172590 [Q86TS9-2]
ENST00000555345; ENSP00000451081; ENSG00000172590 [Q86TS9-2]
ENST00000556840; ENSP00000451481; ENSG00000172590 [Q86TS9-2]
GeneIDi122704
KEGGihsa:122704
UCSCiuc001wgw.4 human [Q86TS9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DW429620 mRNA No translation available.
BX248749 mRNA Translation: CAD66556.1 Different initiation.
AL135998 Genomic DNA No translation available.
CH471078 Genomic DNA Translation: EAW66238.1
CH471078 Genomic DNA Translation: EAW66240.1
CH471078 Genomic DNA Translation: EAW66241.1
CH471078 Genomic DNA Translation: EAW66242.1
CH471078 Genomic DNA Translation: EAW66244.1
BC068070 mRNA Translation: AAH68070.1
BU600884 mRNA No translation available.
CCDSiCCDS41917.1 [Q86TS9-1]
CCDS41918.1 [Q86TS9-2]
CCDS9575.1 [Q86TS9-3]
CCDS9576.1 [Q86TS9-4]
RefSeqiNP_848026.1, NM_178336.2 [Q86TS9-1]
NP_851313.1, NM_180982.2 [Q86TS9-3]
NP_851821.1, NM_181304.2 [Q86TS9-2]
NP_851822.1, NM_181305.2 [Q86TS9-2]
NP_851823.1, NM_181306.2 [Q86TS9-2]
NP_851824.1, NM_181307.2 [Q86TS9-4]
XP_005267385.1, XM_005267328.3 [Q86TS9-2]
UniGeneiHs.355935

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40j6-123[»]
5OOLelectron microscopy3.06j1-123[»]
5OOMelectron microscopy3.03j1-123[»]
ProteinModelPortaliQ86TS9
SMRiQ86TS9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125788, 64 interactors
CORUMiQ86TS9
IntActiQ86TS9, 6 interactors
STRINGi9606.ENSP00000347277

PTM databases

iPTMnetiQ86TS9
PhosphoSitePlusiQ86TS9

Polymorphism and mutation databases

BioMutaiMRPL52
DMDMi124053357

Proteomic databases

EPDiQ86TS9
MaxQBiQ86TS9
PaxDbiQ86TS9
PeptideAtlasiQ86TS9
PRIDEiQ86TS9
ProteomicsDBi69730
TopDownProteomicsiQ86TS9-1 [Q86TS9-1]
Q86TS9-3 [Q86TS9-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355151; ENSP00000347277; ENSG00000172590 [Q86TS9-1]
ENST00000397496; ENSP00000380633; ENSG00000172590 [Q86TS9-3]
ENST00000397505; ENSP00000380642; ENSG00000172590 [Q86TS9-4]
ENST00000553711; ENSP00000451303; ENSG00000172590 [Q86TS9-2]
ENST00000555345; ENSP00000451081; ENSG00000172590 [Q86TS9-2]
ENST00000556840; ENSP00000451481; ENSG00000172590 [Q86TS9-2]
GeneIDi122704
KEGGihsa:122704
UCSCiuc001wgw.4 human [Q86TS9-1]

Organism-specific databases

CTDi122704
EuPathDBiHostDB:ENSG00000172590.18
GeneCardsiMRPL52
HGNCiHGNC:16655 MRPL52
HPAiHPA012319
MIMi611856 gene
neXtProtiNX_Q86TS9
OpenTargetsiENSG00000172590
PharmGKBiPA30985
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J2WG Eukaryota
ENOG4111XV4 LUCA
GeneTreeiENSGT00390000005763
HOGENOMiHOG000293349
HOVERGENiHBG093902
InParanoidiQ86TS9
KOiK17433
OMAiIDQKWRA
OrthoDBiEOG091G0YE9
PhylomeDBiQ86TS9
TreeFamiTF323872

Enzyme and pathway databases

ReactomeiR-HSA-5368286 Mitochondrial translation initiation
R-HSA-5389840 Mitochondrial translation elongation
R-HSA-5419276 Mitochondrial translation termination

Miscellaneous databases

ChiTaRSiMRPL52 human
GenomeRNAii122704
PROiPR:Q86TS9
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000172590 Expressed in 202 organ(s), highest expression level in left adrenal gland
CleanExiHS_MRPL52
ExpressionAtlasiQ86TS9 baseline and differential
GenevisibleiQ86TS9 HS

Family and domain databases

InterProiView protein in InterPro
IPR034596 MRPL52
PANTHERiPTHR34090 PTHR34090, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRM52_HUMAN
AccessioniPrimary (citable) accession number: Q86TS9
Secondary accession number(s): A6NMQ8
, A8MXK5, A8MYI6, G3XCN9, Q6NVH8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: January 23, 2007
Last modified: November 7, 2018
This is version 115 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Ribosomal proteins
    Ribosomal proteins families and list of entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again