Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

tRNA 2'-phosphotransferase 1

Gene

TRPT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processtRNA processing
LigandNAD

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.1.160 2681

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
tRNA 2'-phosphotransferase 1 (EC:2.7.1.160)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TRPT1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000149743.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20316 TRPT1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610470 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86TN4

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000149743

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134964265

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TRPT1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
124053420

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002733631 – 253tRNA 2'-phosphotransferase 1Add BLAST253

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei240PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q86TN4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86TN4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q86TN4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86TN4

PeptideAtlas

More...
PeptideAtlasi
Q86TN4

PRoteomics IDEntifications database

More...
PRIDEi
Q86TN4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
69716
69717 [Q86TN4-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86TN4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86TN4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Weakly or not expressed in lung, spleen, small intestine and peripheral blood leukocytes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000149743 Expressed in 194 organ(s), highest expression level in gastrocnemius

CleanEx database of gene expression profiles

More...
CleanExi
HS_TRPT1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q86TN4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86TN4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA038705
HPA038706

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123736, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q86TN4, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000378050

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q86TN4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the KptA/TPT1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2278 Eukaryota
COG1859 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000002731

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000229875

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG092612

KEGG Orthology (KO)

More...
KOi
K10669

Identification of Orthologs from Complete Genome Data

More...
OMAi
SANGVWL

Database of Orthologous Groups

More...
OrthoDBi
1460780at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86TN4

TreeFam database of animal gene trees

More...
TreeFami
TF324127

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002745 Ptrans_KptA/Tpt1

The PANTHER Classification System

More...
PANTHERi
PTHR12684 PTHR12684, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01885 PTS_2-RNA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86TN4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNFSGGGRQE AAGSRGRRAP RPREQDRDVQ LSKALSYALR HGALKLGLPM
60 70 80 90 100
GADGFVPLGT LLQLPQFRGF SAEDVQRVVD TNRKQRFALQ LGDPSTGLLI
110 120 130 140 150
RANQGHSLQV PKLELMPLET PQALPPMLVH GTFWKHWPSI LLKGLSCQGR
160 170 180 190 200
THIHLAPGLP GDPGIISGMR SHCEIAVFID GPLALADGIP FFRSANGVIL
210 220 230 240 250
TPGNTDGFLL PKYFKEALQL RPTRKPLSLA GDEETECQSS PKHSSRERRR

IQQ
Length:253
Mass (Da):27,742
Last modified:January 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6209F45DC3DB5CBF
GO
Isoform 2 (identifier: Q86TN4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: Missing.

Note: No experimental confirmation available.
Show »
Length:204
Mass (Da):22,427
Checksum:i5B7E72C0D6F702E4
GO
Isoform 3 (identifier: Q86TN4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-224: DGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTR → G

Note: No experimental confirmation available.
Show »
Length:216
Mass (Da):23,566
Checksum:i5DA5CBDEAD3EC3EC
GO
Isoform 4 (identifier: Q86TN4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-109: Q → QVG

Note: No experimental confirmation available.
Show »
Length:255
Mass (Da):27,898
Checksum:i6759213814CCB3BF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H6B6F5H6B6_HUMAN
tRNA 2'-phosphotransferase 1
TRPT1
167Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H8A0F5H8A0_HUMAN
tRNA 2'-phosphotransferase 1
TRPT1
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YGY9H0YGY9_HUMAN
tRNA 2'-phosphotransferase 1
TRPT1
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H1K3F5H1K3_HUMAN
tRNA 2'-phosphotransferase 1
TRPT1
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0301343F → L. Corresponds to variant dbSNP:rs12788168Ensembl.1
Natural variantiVAR_030135172H → R2 PublicationsCorresponds to variant dbSNP:rs1059440Ensembl.1
Natural variantiVAR_030136221R → C. Corresponds to variant dbSNP:rs11549690Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0225241 – 49Missing in isoform 2. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_045827109Q → QVG in isoform 4. Curated1
Alternative sequenceiVSP_045273187 – 224DGIPF…LRPTR → G in isoform 3. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY211494 mRNA Translation: AAO62941.1
AP005668 Genomic DNA No translation available.
AP006334 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74202.1
BC005133 mRNA Translation: AAH05133.1
BQ672032 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31595.1 [Q86TN4-1]
CCDS44639.1 [Q86TN4-2]
CCDS53652.1 [Q86TN4-4]
CCDS53653.1 [Q86TN4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001028850.2, NM_001033678.3 [Q86TN4-1]
NP_001153861.1, NM_001160389.1 [Q86TN4-4]
NP_001153862.1, NM_001160390.1 [Q86TN4-1]
NP_001153864.1, NM_001160392.1 [Q86TN4-3]
NP_001153865.1, NM_001160393.1
NP_001317227.1, NM_001330298.1
NP_113660.1, NM_031472.3 [Q86TN4-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.326586

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000317459; ENSP00000314073; ENSG00000149743 [Q86TN4-1]
ENST00000394546; ENSP00000378050; ENSG00000149743 [Q86TN4-4]
ENST00000394547; ENSP00000378051; ENSG00000149743 [Q86TN4-2]
ENST00000541278; ENSP00000438683; ENSG00000149743 [Q86TN4-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
83707

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:83707

UCSC genome browser

More...
UCSCi
uc001nyn.4 human [Q86TN4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY211494 mRNA Translation: AAO62941.1
AP005668 Genomic DNA No translation available.
AP006334 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74202.1
BC005133 mRNA Translation: AAH05133.1
BQ672032 mRNA No translation available.
CCDSiCCDS31595.1 [Q86TN4-1]
CCDS44639.1 [Q86TN4-2]
CCDS53652.1 [Q86TN4-4]
CCDS53653.1 [Q86TN4-3]
RefSeqiNP_001028850.2, NM_001033678.3 [Q86TN4-1]
NP_001153861.1, NM_001160389.1 [Q86TN4-4]
NP_001153862.1, NM_001160390.1 [Q86TN4-1]
NP_001153864.1, NM_001160392.1 [Q86TN4-3]
NP_001153865.1, NM_001160393.1
NP_001317227.1, NM_001330298.1
NP_113660.1, NM_031472.3 [Q86TN4-2]
UniGeneiHs.326586

3D structure databases

ProteinModelPortaliQ86TN4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123736, 9 interactors
IntActiQ86TN4, 1 interactor
STRINGi9606.ENSP00000378050

PTM databases

iPTMnetiQ86TN4
PhosphoSitePlusiQ86TN4

Polymorphism and mutation databases

BioMutaiTRPT1
DMDMi124053420

Proteomic databases

EPDiQ86TN4
jPOSTiQ86TN4
MaxQBiQ86TN4
PaxDbiQ86TN4
PeptideAtlasiQ86TN4
PRIDEiQ86TN4
ProteomicsDBi69716
69717 [Q86TN4-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
83707
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317459; ENSP00000314073; ENSG00000149743 [Q86TN4-1]
ENST00000394546; ENSP00000378050; ENSG00000149743 [Q86TN4-4]
ENST00000394547; ENSP00000378051; ENSG00000149743 [Q86TN4-2]
ENST00000541278; ENSP00000438683; ENSG00000149743 [Q86TN4-3]
GeneIDi83707
KEGGihsa:83707
UCSCiuc001nyn.4 human [Q86TN4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83707
EuPathDBiHostDB:ENSG00000149743.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TRPT1
HGNCiHGNC:20316 TRPT1
HPAiHPA038705
HPA038706
MIMi610470 gene
neXtProtiNX_Q86TN4
OpenTargetsiENSG00000149743
PharmGKBiPA134964265

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2278 Eukaryota
COG1859 LUCA
GeneTreeiENSGT00390000002731
HOGENOMiHOG000229875
HOVERGENiHBG092612
KOiK10669
OMAiSANGVWL
OrthoDBi1460780at2759
PhylomeDBiQ86TN4
TreeFamiTF324127

Enzyme and pathway databases

BRENDAi2.7.1.160 2681

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TRPT1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
83707

Protein Ontology

More...
PROi
PR:Q86TN4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000149743 Expressed in 194 organ(s), highest expression level in gastrocnemius
CleanExiHS_TRPT1
ExpressionAtlasiQ86TN4 baseline and differential
GenevisibleiQ86TN4 HS

Family and domain databases

InterProiView protein in InterPro
IPR002745 Ptrans_KptA/Tpt1
PANTHERiPTHR12684 PTHR12684, 1 hit
PfamiView protein in Pfam
PF01885 PTS_2-RNA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTRPT1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86TN4
Secondary accession number(s): A8MU17
, A8MYC9, F5H2B2, Q9BSB9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: January 23, 2007
Last modified: January 16, 2019
This is version 119 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again