Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dipeptidyl peptidase 9

Gene

DPP9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Dipeptidyl peptidase that cleaves off N-terminal dipeptides from proteins having a Pro or Ala residue at position 2.

Catalytic activityi

Release of an N-terminal dipeptide, Xaa-Yaa-|-Zaa-, from a polypeptide, preferentially when Yaa is Pro, provided Zaa is neither Pro nor hydroxyproline.3 Publications

Activity regulationi

Inhibited by the serine proteinase inhibitor 4-(2-aminoethyl)benzenesulphonyl fluoride (AEBSF), and by di-isopropylfuorophosphate.1 Publication

Kineticsi

  1. KM=161 µM for Ala-Pro-AMC2 Publications
  2. KM=180 µM for Ala-Pro-AFC2 Publications

    pH dependencei

    Optimum pH is 7.5-8.5. Little activity below pH 6.5.2 Publications

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Active sitei730Charge relay systemBy similarity1
    Active sitei808Charge relay systemBy similarity1
    Active sitei840Charge relay systemBy similarity1

    GO - Molecular functioni

    • aminopeptidase activity Source: UniProtKB-KW
    • identical protein binding Source: IntAct
    • serine-type peptidase activity Source: UniProtKB-KW

    Keywordsi

    Molecular functionAminopeptidase, Hydrolase, Protease, Serine protease

    Enzyme and pathway databases

    SABIO-RKiQ86TI2

    Protein family/group databases

    ESTHERihuman-DPP9 DPP4N_Peptidase_S9
    MEROPSiS09.019

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Dipeptidyl peptidase 9 (EC:3.4.14.5)
    Short name:
    DP9
    Alternative name(s):
    Dipeptidyl peptidase IV-related protein 2
    Short name:
    DPRP-2
    Dipeptidyl peptidase IX
    Short name:
    DPP IX
    Dipeptidyl peptidase-like protein 9
    Short name:
    DPLP9
    Gene namesi
    Name:DPP9
    Synonyms:DPRP2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 19

    Organism-specific databases

    EuPathDBiHostDB:ENSG00000142002.16
    HGNCiHGNC:18648 DPP9
    MIMi608258 gene
    neXtProtiNX_Q86TI2

    Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    DisGeNETi91039
    MalaCardsiDPP9
    OpenTargetsiENSG00000142002
    Orphaneti2032 Idiopathic pulmonary fibrosis
    PharmGKBiPA38620

    Chemistry databases

    ChEMBLiCHEMBL4793
    GuidetoPHARMACOLOGYi2357

    Polymorphism and mutation databases

    DMDMi67460390

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Initiator methionineiRemovedCombined sources
    ChainiPRO_00001224152 – 863Dipeptidyl peptidase 9Add BLAST862

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Modified residuei2N-acetylalanineCombined sources1

    Keywords - PTMi

    Acetylation

    Proteomic databases

    EPDiQ86TI2
    MaxQBiQ86TI2
    PaxDbiQ86TI2
    PeptideAtlasiQ86TI2
    PRIDEiQ86TI2
    ProteomicsDBi69697
    69698 [Q86TI2-2]
    69700 [Q86TI2-4]

    PTM databases

    iPTMnetiQ86TI2
    PhosphoSitePlusiQ86TI2

    Expressioni

    Tissue specificityi

    Ubiquitously expressed, with highest levels in liver, heart and muscle, and lowest levels in brain.3 Publications

    Gene expression databases

    BgeeiENSG00000142002 Expressed in 184 organ(s), highest expression level in skeletal muscle tissue
    ExpressionAtlasiQ86TI2 baseline and differential
    GenevisibleiQ86TI2 HS

    Organism-specific databases

    HPAiHPA036059

    Interactioni

    Subunit structurei

    Homodimer.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    itself2EBI-7475352,EBI-7475352

    GO - Molecular functioni

    Protein-protein interaction databases

    BioGridi124789, 51 interactors
    IntActiQ86TI2, 5 interactors
    MINTiQ86TI2
    STRINGi9606.ENSP00000262960

    Chemistry databases

    BindingDBiQ86TI2

    Structurei

    Secondary structure

    1863
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    ProteinModelPortaliQ86TI2
    SMRiQ86TI2
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the peptidase S9B family. DPPIV subfamily.Curated

    Phylogenomic databases

    eggNOGiKOG2281 Eukaryota
    COG1506 LUCA
    GeneTreeiENSGT00760000119233
    HOGENOMiHOG000006870
    HOVERGENiHBG061620
    InParanoidiQ86TI2
    KOiK08656
    OMAiWASMMEA
    OrthoDBiEOG091G05F9
    PhylomeDBiQ86TI2
    TreeFamiTF313309

    Family and domain databases

    Gene3Di2.140.10.30, 1 hit
    3.40.50.1820, 1 hit
    InterProiView protein in InterPro
    IPR029058 AB_hydrolase
    IPR001375 Peptidase_S9
    IPR002469 Peptidase_S9B_N
    IPR038554 Peptidase_S9B_N_sf
    PfamiView protein in Pfam
    PF00930 DPPIV_N, 1 hit
    PF00326 Peptidase_S9, 1 hit
    SUPFAMiSSF53474 SSF53474, 1 hit

    Sequences (3+)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 3 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q86TI2-1) [UniParc]FASTAAdd to basket
    Also known as: DPP9-S, Short

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MATTGTPTAD RGDAAATDDP AARFQVQKHS WDGLRSIIHG SRKYSGLIVN
    60 70 80 90 100
    KAPHDFQFVQ KTDESGPHSH RLYYLGMPYG SRENSLLYSE IPKKVRKEAL
    110 120 130 140 150
    LLLSWKQMLD HFQATPHHGV YSREEELLRE RKRLGVFGIT SYDFHSESGL
    160 170 180 190 200
    FLFQASNSLF HCRDGGKNGF MVSPMKPLEI KTQCSGPRMD PKICPADPAF
    210 220 230 240 250
    FSFINNSDLW VANIETGEER RLTFCHQGLS NVLDDPKSAG VATFVIQEEF
    260 270 280 290 300
    DRFTGYWWCP TASWEGSEGL KTLRILYEEV DESEVEVIHV PSPALEERKT
    310 320 330 340 350
    DSYRYPRTGS KNPKIALKLA EFQTDSQGKI VSTQEKELVQ PFSSLFPKVE
    360 370 380 390 400
    YIARAGWTRD GKYAWAMFLD RPQQWLQLVL LPPALFIPST ENEEQRLASA
    410 420 430 440 450
    RAVPRNVQPY VVYEEVTNVW INVHDIFYPF PQSEGEDELC FLRANECKTG
    460 470 480 490 500
    FCHLYKVTAV LKSQGYDWSE PFSPGEDEFK CPIKEEIALT SGEWEVLARH
    510 520 530 540 550
    GSKIWVNEET KLVYFQGTKD TPLEHHLYVV SYEAAGEIVR LTTPGFSHSC
    560 570 580 590 600
    SMSQNFDMFV SHYSSVSTPP CVHVYKLSGP DDDPLHKQPR FWASMMEAAS
    610 620 630 640 650
    CPPDYVPPEI FHFHTRSDVR LYGMIYKPHA LQPGKKHPTV LFVYGGPQVQ
    660 670 680 690 700
    LVNNSFKGIK YLRLNTLASL GYAVVVIDGR GSCQRGLRFE GALKNQMGQV
    710 720 730 740 750
    EIEDQVEGLQ FVAEKYGFID LSRVAIHGWS YGGFLSLMGL IHKPQVFKVA
    760 770 780 790 800
    IAGAPVTVWM AYDTGYTERY MDVPENNQHG YEAGSVALHV EKLPNEPNRL
    810 820 830 840 850
    LILHGFLDEN VHFFHTNFLV SQLIRAGKPY QLQIYPNERH SIRCPESGEH
    860
    YEVTLLHFLQ EYL
    Length:863
    Mass (Da):98,263
    Last modified:June 7, 2005 - v3
    Checksum:i40FE0B78E26CDED5
    GO
    Isoform 2 (identifier: Q86TI2-2) [UniParc]FASTAAdd to basket
    Also known as: DPP9-L, Long

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MRKVKKLRLDKENTGSWRSFSLNSEGAERM

    Note: Active peptidase. Contains a nuclear localization signal at positions 2-9.1 Publication
    Show »
    Length:892
    Mass (Da):101,669
    Checksum:i2CDB8E40E428AE73
    GO
    Isoform 3 (identifier: Q86TI2-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         832-858: Missing.

    Show »
    Length:836
    Mass (Da):95,013
    Checksum:iEF3B224CF112B857
    GO

    Computationally mapped potential isoform sequencesi

    There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    M0R2A8M0R2A8_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    518Annotation score:
    M0QXI5M0QXI5_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    220Annotation score:
    M0R162M0R162_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    151Annotation score:
    M0R1L4M0R1L4_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    141Annotation score:
    M0R3E8M0R3E8_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    68Annotation score:
    A0A2R8YF65A0A2R8YF65_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    154Annotation score:
    M0R334M0R334_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    62Annotation score:
    M0R3C4M0R3C4_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    123Annotation score:
    M0QXA6M0QXA6_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    67Annotation score:
    M0R2G6M0R2G6_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    140Annotation score:
    There are more potential isoformsShow all

    Sequence cautioni

    The sequence AAC33801 differs from that shown. Reason: Erroneous gene model prediction.Curated
    The sequence AAC62840 differs from that shown. Reason: Erroneous gene model prediction.Curated
    The sequence AAH37948 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence AAL47179 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence AAO73880 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
    The sequence BAB70784 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence BAC11362 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence BAC85150 differs from that shown. Probable cloning artifact.Curated
    The sequence BAD18643 differs from that shown. Aberrant splicing.Curated
    The sequence CAD39039 differs from that shown. Reason: Frameshift at positions 432 and 460.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Sequence conflicti204I → N in AAO73880 (PubMed:15245913).Curated1
    Sequence conflicti204I → N in AAQ83119 (PubMed:15245913).Curated1
    Sequence conflicti461L → F in CAD39039 (PubMed:17974005).Curated1
    Sequence conflicti571C → W in BAC85150 (PubMed:14702039).Curated1
    Sequence conflicti709L → P in BAD18643 (PubMed:14702039).Curated1
    Sequence conflicti753G → C in BAB70784 (PubMed:14702039).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_0138651M → MRKVKKLRLDKENTGSWRSF SLNSEGAERM in isoform 2. 4 Publications1
    Alternative sequenceiVSP_013869832 – 858Missing in isoform 3. 1 PublicationAdd BLAST27

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF452102 mRNA Translation: AAL47179.1 Different initiation.
    AY172660 mRNA Translation: AAO17262.1
    AF542510 mRNA Translation: AAO73880.2 Different initiation.
    AY374518 mRNA Translation: AAQ83119.1
    DQ417928 mRNA Translation: ABD83624.1
    AK054656 mRNA Translation: BAB70784.1 Different initiation.
    AK075030 mRNA Translation: BAC11362.1 Different initiation.
    AK122654 mRNA Translation: BAG53644.1
    AK131100 mRNA Translation: BAC85150.1 Sequence problems.
    AK131499 mRNA Translation: BAD18643.1 Sequence problems.
    AC005594 Genomic DNA Translation: AAC33801.1 Sequence problems.
    AC005783 Genomic DNA Translation: AAC62840.1 Sequence problems.
    CH471139 Genomic DNA Translation: EAW69199.1
    CH471139 Genomic DNA Translation: EAW69201.1
    BC000970 mRNA Translation: AAH00970.1
    BC037948 mRNA Translation: AAH37948.1 Different initiation.
    AL834376 mRNA Translation: CAD39039.3 Frameshift.
    CR627380 mRNA Translation: CAH10477.1
    CCDSiCCDS45928.1 [Q86TI2-2]
    RefSeqiNP_631898.3, NM_139159.4 [Q86TI2-2]
    XP_005259730.1, XM_005259673.2 [Q86TI2-2]
    XP_011526710.1, XM_011528408.1 [Q86TI2-2]
    XP_011526712.1, XM_011528410.1 [Q86TI2-1]
    UniGeneiHs.515081

    Genome annotation databases

    EnsembliENST00000262960; ENSP00000262960; ENSG00000142002 [Q86TI2-2]
    ENST00000594671; ENSP00000472224; ENSG00000142002 [Q86TI2-4]
    ENST00000598800; ENSP00000469603; ENSG00000142002 [Q86TI2-1]
    GeneIDi91039
    KEGGihsa:91039
    UCSCiuc002mba.5 human [Q86TI2-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Similar proteinsi

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF452102 mRNA Translation: AAL47179.1 Different initiation.
    AY172660 mRNA Translation: AAO17262.1
    AF542510 mRNA Translation: AAO73880.2 Different initiation.
    AY374518 mRNA Translation: AAQ83119.1
    DQ417928 mRNA Translation: ABD83624.1
    AK054656 mRNA Translation: BAB70784.1 Different initiation.
    AK075030 mRNA Translation: BAC11362.1 Different initiation.
    AK122654 mRNA Translation: BAG53644.1
    AK131100 mRNA Translation: BAC85150.1 Sequence problems.
    AK131499 mRNA Translation: BAD18643.1 Sequence problems.
    AC005594 Genomic DNA Translation: AAC33801.1 Sequence problems.
    AC005783 Genomic DNA Translation: AAC62840.1 Sequence problems.
    CH471139 Genomic DNA Translation: EAW69199.1
    CH471139 Genomic DNA Translation: EAW69201.1
    BC000970 mRNA Translation: AAH00970.1
    BC037948 mRNA Translation: AAH37948.1 Different initiation.
    AL834376 mRNA Translation: CAD39039.3 Frameshift.
    CR627380 mRNA Translation: CAH10477.1
    CCDSiCCDS45928.1 [Q86TI2-2]
    RefSeqiNP_631898.3, NM_139159.4 [Q86TI2-2]
    XP_005259730.1, XM_005259673.2 [Q86TI2-2]
    XP_011526710.1, XM_011528408.1 [Q86TI2-2]
    XP_011526712.1, XM_011528410.1 [Q86TI2-1]
    UniGeneiHs.515081

    3D structure databases

    Select the link destinations:
    PDBei
    RCSB PDBi
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    6EOQX-ray3.00A/B/C/D1-863[»]
    6EORX-ray2.90A/B/C/D1-863[»]
    ProteinModelPortaliQ86TI2
    SMRiQ86TI2
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi124789, 51 interactors
    IntActiQ86TI2, 5 interactors
    MINTiQ86TI2
    STRINGi9606.ENSP00000262960

    Chemistry databases

    BindingDBiQ86TI2
    ChEMBLiCHEMBL4793
    GuidetoPHARMACOLOGYi2357

    Protein family/group databases

    ESTHERihuman-DPP9 DPP4N_Peptidase_S9
    MEROPSiS09.019

    PTM databases

    iPTMnetiQ86TI2
    PhosphoSitePlusiQ86TI2

    Polymorphism and mutation databases

    DMDMi67460390

    Proteomic databases

    EPDiQ86TI2
    MaxQBiQ86TI2
    PaxDbiQ86TI2
    PeptideAtlasiQ86TI2
    PRIDEiQ86TI2
    ProteomicsDBi69697
    69698 [Q86TI2-2]
    69700 [Q86TI2-4]

    Protocols and materials databases

    DNASUi91039
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000262960; ENSP00000262960; ENSG00000142002 [Q86TI2-2]
    ENST00000594671; ENSP00000472224; ENSG00000142002 [Q86TI2-4]
    ENST00000598800; ENSP00000469603; ENSG00000142002 [Q86TI2-1]
    GeneIDi91039
    KEGGihsa:91039
    UCSCiuc002mba.5 human [Q86TI2-1]

    Organism-specific databases

    CTDi91039
    DisGeNETi91039
    EuPathDBiHostDB:ENSG00000142002.16
    GeneCardsiDPP9
    H-InvDBiHIX0027578
    HGNCiHGNC:18648 DPP9
    HPAiHPA036059
    MalaCardsiDPP9
    MIMi608258 gene
    neXtProtiNX_Q86TI2
    OpenTargetsiENSG00000142002
    Orphaneti2032 Idiopathic pulmonary fibrosis
    PharmGKBiPA38620
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiKOG2281 Eukaryota
    COG1506 LUCA
    GeneTreeiENSGT00760000119233
    HOGENOMiHOG000006870
    HOVERGENiHBG061620
    InParanoidiQ86TI2
    KOiK08656
    OMAiWASMMEA
    OrthoDBiEOG091G05F9
    PhylomeDBiQ86TI2
    TreeFamiTF313309

    Enzyme and pathway databases

    SABIO-RKiQ86TI2

    Miscellaneous databases

    ChiTaRSiDPP9 human
    GeneWikiiDPP9
    GenomeRNAii91039
    PROiPR:Q86TI2
    SOURCEiSearch...

    Gene expression databases

    BgeeiENSG00000142002 Expressed in 184 organ(s), highest expression level in skeletal muscle tissue
    ExpressionAtlasiQ86TI2 baseline and differential
    GenevisibleiQ86TI2 HS

    Family and domain databases

    Gene3Di2.140.10.30, 1 hit
    3.40.50.1820, 1 hit
    InterProiView protein in InterPro
    IPR029058 AB_hydrolase
    IPR001375 Peptidase_S9
    IPR002469 Peptidase_S9B_N
    IPR038554 Peptidase_S9B_N_sf
    PfamiView protein in Pfam
    PF00930 DPPIV_N, 1 hit
    PF00326 Peptidase_S9, 1 hit
    SUPFAMiSSF53474 SSF53474, 1 hit
    ProtoNetiSearch...

    Entry informationi

    Entry nameiDPP9_HUMAN
    AccessioniPrimary (citable) accession number: Q86TI2
    Secondary accession number(s): O75273
    , O75868, Q1ZZB8, Q6AI37, Q6UAL0, Q6ZMT2, Q6ZNJ5, Q8N2J7, Q8N3F5, Q8WXD8, Q96NT8, Q9BVR3
    Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
    Last sequence update: June 7, 2005
    Last modified: September 12, 2018
    This is version 144 of the entry and version 3 of the sequence. See complete history.
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Peptidase families
      Classification of peptidase families and list of entries
    2. SIMILARITY comments
      Index of protein domains and families
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again