Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dipeptidyl peptidase 9

Gene

DPP9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Dipeptidyl peptidase that cleaves off N-terminal dipeptides from proteins having a Pro or Ala residue at position 2.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by the serine proteinase inhibitor 4-(2-aminoethyl)benzenesulphonyl fluoride (AEBSF), and by di-isopropylfuorophosphate.1 Publication

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=161 µM for Ala-Pro-AMC2 Publications
  2. KM=180 µM for Ala-Pro-AFC2 Publications

    pH dependencei

    Optimum pH is 7.5-8.5. Little activity below pH 6.5.2 Publications

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei730Charge relay systemBy similarity1
    Active sitei808Charge relay systemBy similarity1
    Active sitei840Charge relay systemBy similarity1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    • aminopeptidase activity Source: UniProtKB-KW
    • identical protein binding Source: IntAct
    • serine-type peptidase activity Source: UniProtKB-KW

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionAminopeptidase, Hydrolase, Protease, Serine protease

    Enzyme and pathway databases

    SABIO-RK: Biochemical Reaction Kinetics Database

    More...
    SABIO-RKi
    Q86TI2

    Protein family/group databases

    ESTHER database of the Alpha/Beta-hydrolase fold superfamily of proteins

    More...
    ESTHERi
    human-DPP9 DPP4N_Peptidase_S9

    MEROPS protease database

    More...
    MEROPSi
    S09.019

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Dipeptidyl peptidase 9 (EC:3.4.14.5)
    Short name:
    DP9
    Alternative name(s):
    Dipeptidyl peptidase IV-related protein 2
    Short name:
    DPRP-2
    Dipeptidyl peptidase IX
    Short name:
    DPP IX
    Dipeptidyl peptidase-like protein 9
    Short name:
    DPLP9
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:DPP9
    Synonyms:DPRP2
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

    Organism-specific databases

    Eukaryotic Pathogen Database Resources

    More...
    EuPathDBi
    HostDB:ENSG00000142002.16

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:18648 DPP9

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    608258 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q86TI2

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    91039

    MalaCards human disease database

    More...
    MalaCardsi
    DPP9

    Open Targets

    More...
    OpenTargetsi
    ENSG00000142002

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More...
    Orphaneti
    2032 Idiopathic pulmonary fibrosis

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA38620

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...
    ChEMBLi
    CHEMBL4793

    IUPHAR/BPS Guide to PHARMACOLOGY

    More...
    GuidetoPHARMACOLOGYi
    2357

    Polymorphism and mutation databases

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    67460390

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001224152 – 863Dipeptidyl peptidase 9Add BLAST862

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1

    Keywords - PTMi

    Acetylation

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q86TI2

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q86TI2

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q86TI2

    PeptideAtlas

    More...
    PeptideAtlasi
    Q86TI2

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q86TI2

    ProteomicsDB human proteome resource

    More...
    ProteomicsDBi
    69697
    69698 [Q86TI2-2]
    69700 [Q86TI2-4]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q86TI2

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q86TI2

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Ubiquitously expressed, with highest levels in liver, heart and muscle, and lowest levels in brain.3 Publications

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000142002 Expressed in 184 organ(s), highest expression level in skeletal muscle tissue

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q86TI2 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q86TI2 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA036059

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Homodimer.1 Publication

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    WithEntry#Exp.IntActNotes
    itself2EBI-7475352,EBI-7475352

    GO - Molecular functioni

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    124789, 53 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q86TI2, 5 interactors

    Molecular INTeraction database

    More...
    MINTi
    Q86TI2

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000262960

    Chemistry databases

    BindingDB database of measured binding affinities

    More...
    BindingDBi
    Q86TI2

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1863
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

    More...
    ProteinModelPortali
    Q86TI2

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q86TI2

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the peptidase S9B family. DPPIV subfamily.Curated

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG2281 Eukaryota
    COG1506 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000158174

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000006870

    The HOVERGEN Database of Homologous Vertebrate Genes

    More...
    HOVERGENi
    HBG061620

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q86TI2

    KEGG Orthology (KO)

    More...
    KOi
    K08656

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    GVTHMTP

    Database of Orthologous Groups

    More...
    OrthoDBi
    EOG091G05F9

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q86TI2

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF313309

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    2.140.10.30, 1 hit
    3.40.50.1820, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR029058 AB_hydrolase
    IPR001375 Peptidase_S9
    IPR002469 Peptidase_S9B_N
    IPR038554 Peptidase_S9B_N_sf

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF00930 DPPIV_N, 1 hit
    PF00326 Peptidase_S9, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF53474 SSF53474, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 3 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q86TI2-1) [UniParc]FASTAAdd to basket
    Also known as: DPP9-S, Short

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MATTGTPTAD RGDAAATDDP AARFQVQKHS WDGLRSIIHG SRKYSGLIVN
    60 70 80 90 100
    KAPHDFQFVQ KTDESGPHSH RLYYLGMPYG SRENSLLYSE IPKKVRKEAL
    110 120 130 140 150
    LLLSWKQMLD HFQATPHHGV YSREEELLRE RKRLGVFGIT SYDFHSESGL
    160 170 180 190 200
    FLFQASNSLF HCRDGGKNGF MVSPMKPLEI KTQCSGPRMD PKICPADPAF
    210 220 230 240 250
    FSFINNSDLW VANIETGEER RLTFCHQGLS NVLDDPKSAG VATFVIQEEF
    260 270 280 290 300
    DRFTGYWWCP TASWEGSEGL KTLRILYEEV DESEVEVIHV PSPALEERKT
    310 320 330 340 350
    DSYRYPRTGS KNPKIALKLA EFQTDSQGKI VSTQEKELVQ PFSSLFPKVE
    360 370 380 390 400
    YIARAGWTRD GKYAWAMFLD RPQQWLQLVL LPPALFIPST ENEEQRLASA
    410 420 430 440 450
    RAVPRNVQPY VVYEEVTNVW INVHDIFYPF PQSEGEDELC FLRANECKTG
    460 470 480 490 500
    FCHLYKVTAV LKSQGYDWSE PFSPGEDEFK CPIKEEIALT SGEWEVLARH
    510 520 530 540 550
    GSKIWVNEET KLVYFQGTKD TPLEHHLYVV SYEAAGEIVR LTTPGFSHSC
    560 570 580 590 600
    SMSQNFDMFV SHYSSVSTPP CVHVYKLSGP DDDPLHKQPR FWASMMEAAS
    610 620 630 640 650
    CPPDYVPPEI FHFHTRSDVR LYGMIYKPHA LQPGKKHPTV LFVYGGPQVQ
    660 670 680 690 700
    LVNNSFKGIK YLRLNTLASL GYAVVVIDGR GSCQRGLRFE GALKNQMGQV
    710 720 730 740 750
    EIEDQVEGLQ FVAEKYGFID LSRVAIHGWS YGGFLSLMGL IHKPQVFKVA
    760 770 780 790 800
    IAGAPVTVWM AYDTGYTERY MDVPENNQHG YEAGSVALHV EKLPNEPNRL
    810 820 830 840 850
    LILHGFLDEN VHFFHTNFLV SQLIRAGKPY QLQIYPNERH SIRCPESGEH
    860
    YEVTLLHFLQ EYL
    Length:863
    Mass (Da):98,263
    Last modified:June 7, 2005 - v3
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i40FE0B78E26CDED5
    GO
    Isoform 2 (identifier: Q86TI2-2) [UniParc]FASTAAdd to basket
    Also known as: DPP9-L, Long

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MRKVKKLRLDKENTGSWRSFSLNSEGAERM

    Note: Active peptidase. Contains a nuclear localization signal at positions 2-9.1 Publication
    Show »
    Length:892
    Mass (Da):101,669
    Checksum:i2CDB8E40E428AE73
    GO
    Isoform 3 (identifier: Q86TI2-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         832-858: Missing.

    Show »
    Length:836
    Mass (Da):95,013
    Checksum:iEF3B224CF112B857
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    M0R2A8M0R2A8_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    518Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    M0QXI5M0QXI5_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    220Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    M0R162M0R162_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    151Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    M0R1L4M0R1L4_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    141Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    M0R3E8M0R3E8_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    68Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A2R8YF65A0A2R8YF65_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    154Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    M0R334M0R334_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    62Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    M0R3C4M0R3C4_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    123Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    M0QXA6M0QXA6_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    67Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    M0R0I1M0R0I1_HUMAN
    Dipeptidyl peptidase 9
    DPP9
    119Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    There are more potential isoformsShow all

    <p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence AAC33801 differs from that shown. Reason: Erroneous gene model prediction.Curated
    The sequence AAC62840 differs from that shown. Reason: Erroneous gene model prediction.Curated
    The sequence AAH37948 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence AAL47179 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence AAO73880 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
    The sequence BAB70784 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence BAC11362 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence BAC85150 differs from that shown. Probable cloning artifact.Curated
    The sequence BAD18643 differs from that shown. Aberrant splicing.Curated
    The sequence CAD39039 differs from that shown. Reason: Frameshift at positions 432 and 460.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti204I → N in AAO73880 (PubMed:15245913).Curated1
    Sequence conflicti204I → N in AAQ83119 (PubMed:15245913).Curated1
    Sequence conflicti461L → F in CAD39039 (PubMed:17974005).Curated1
    Sequence conflicti571C → W in BAC85150 (PubMed:14702039).Curated1
    Sequence conflicti709L → P in BAD18643 (PubMed:14702039).Curated1
    Sequence conflicti753G → C in BAB70784 (PubMed:14702039).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0138651M → MRKVKKLRLDKENTGSWRSF SLNSEGAERM in isoform 2. 4 Publications1
    Alternative sequenceiVSP_013869832 – 858Missing in isoform 3. 1 PublicationAdd BLAST27

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AF452102 mRNA Translation: AAL47179.1 Different initiation.
    AY172660 mRNA Translation: AAO17262.1
    AF542510 mRNA Translation: AAO73880.2 Different initiation.
    AY374518 mRNA Translation: AAQ83119.1
    DQ417928 mRNA Translation: ABD83624.1
    AK054656 mRNA Translation: BAB70784.1 Different initiation.
    AK075030 mRNA Translation: BAC11362.1 Different initiation.
    AK122654 mRNA Translation: BAG53644.1
    AK131100 mRNA Translation: BAC85150.1 Sequence problems.
    AK131499 mRNA Translation: BAD18643.1 Sequence problems.
    AC005594 Genomic DNA Translation: AAC33801.1 Sequence problems.
    AC005783 Genomic DNA Translation: AAC62840.1 Sequence problems.
    CH471139 Genomic DNA Translation: EAW69199.1
    CH471139 Genomic DNA Translation: EAW69201.1
    BC000970 mRNA Translation: AAH00970.1
    BC037948 mRNA Translation: AAH37948.1 Different initiation.
    AL834376 mRNA Translation: CAD39039.3 Frameshift.
    CR627380 mRNA Translation: CAH10477.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS45928.1 [Q86TI2-2]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_631898.3, NM_139159.4 [Q86TI2-2]
    XP_005259730.1, XM_005259673.2 [Q86TI2-2]
    XP_011526710.1, XM_011528408.1 [Q86TI2-2]
    XP_011526712.1, XM_011528410.1 [Q86TI2-1]

    UniGene gene-oriented nucleotide sequence clusters

    More...
    UniGenei
    Hs.515081

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000262960; ENSP00000262960; ENSG00000142002 [Q86TI2-2]
    ENST00000594671; ENSP00000472224; ENSG00000142002 [Q86TI2-4]
    ENST00000598800; ENSP00000469603; ENSG00000142002 [Q86TI2-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    91039

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:91039

    UCSC genome browser

    More...
    UCSCi
    uc002mba.5 human [Q86TI2-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF452102 mRNA Translation: AAL47179.1 Different initiation.
    AY172660 mRNA Translation: AAO17262.1
    AF542510 mRNA Translation: AAO73880.2 Different initiation.
    AY374518 mRNA Translation: AAQ83119.1
    DQ417928 mRNA Translation: ABD83624.1
    AK054656 mRNA Translation: BAB70784.1 Different initiation.
    AK075030 mRNA Translation: BAC11362.1 Different initiation.
    AK122654 mRNA Translation: BAG53644.1
    AK131100 mRNA Translation: BAC85150.1 Sequence problems.
    AK131499 mRNA Translation: BAD18643.1 Sequence problems.
    AC005594 Genomic DNA Translation: AAC33801.1 Sequence problems.
    AC005783 Genomic DNA Translation: AAC62840.1 Sequence problems.
    CH471139 Genomic DNA Translation: EAW69199.1
    CH471139 Genomic DNA Translation: EAW69201.1
    BC000970 mRNA Translation: AAH00970.1
    BC037948 mRNA Translation: AAH37948.1 Different initiation.
    AL834376 mRNA Translation: CAD39039.3 Frameshift.
    CR627380 mRNA Translation: CAH10477.1
    CCDSiCCDS45928.1 [Q86TI2-2]
    RefSeqiNP_631898.3, NM_139159.4 [Q86TI2-2]
    XP_005259730.1, XM_005259673.2 [Q86TI2-2]
    XP_011526710.1, XM_011528408.1 [Q86TI2-2]
    XP_011526712.1, XM_011528410.1 [Q86TI2-1]
    UniGeneiHs.515081

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...
    PDBei

    Protein Data Bank RCSB

    More...
    RCSB PDBi

    Protein Data Bank Japan

    More...
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    6EOQX-ray3.00A/B/C/D1-863[»]
    6EORX-ray2.90A/B/C/D1-863[»]
    ProteinModelPortaliQ86TI2
    SMRiQ86TI2
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi124789, 53 interactors
    IntActiQ86TI2, 5 interactors
    MINTiQ86TI2
    STRINGi9606.ENSP00000262960

    Chemistry databases

    BindingDBiQ86TI2
    ChEMBLiCHEMBL4793
    GuidetoPHARMACOLOGYi2357

    Protein family/group databases

    ESTHERihuman-DPP9 DPP4N_Peptidase_S9
    MEROPSiS09.019

    PTM databases

    iPTMnetiQ86TI2
    PhosphoSitePlusiQ86TI2

    Polymorphism and mutation databases

    DMDMi67460390

    Proteomic databases

    EPDiQ86TI2
    MaxQBiQ86TI2
    PaxDbiQ86TI2
    PeptideAtlasiQ86TI2
    PRIDEiQ86TI2
    ProteomicsDBi69697
    69698 [Q86TI2-2]
    69700 [Q86TI2-4]

    Protocols and materials databases

    The DNASU plasmid repository

    More...
    DNASUi
    91039
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000262960; ENSP00000262960; ENSG00000142002 [Q86TI2-2]
    ENST00000594671; ENSP00000472224; ENSG00000142002 [Q86TI2-4]
    ENST00000598800; ENSP00000469603; ENSG00000142002 [Q86TI2-1]
    GeneIDi91039
    KEGGihsa:91039
    UCSCiuc002mba.5 human [Q86TI2-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    91039
    DisGeNETi91039
    EuPathDBiHostDB:ENSG00000142002.16

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    DPP9

    H-Invitational Database, human transcriptome db

    More...
    H-InvDBi
    HIX0027578
    HGNCiHGNC:18648 DPP9
    HPAiHPA036059
    MalaCardsiDPP9
    MIMi608258 gene
    neXtProtiNX_Q86TI2
    OpenTargetsiENSG00000142002
    Orphaneti2032 Idiopathic pulmonary fibrosis
    PharmGKBiPA38620

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG2281 Eukaryota
    COG1506 LUCA
    GeneTreeiENSGT00940000158174
    HOGENOMiHOG000006870
    HOVERGENiHBG061620
    InParanoidiQ86TI2
    KOiK08656
    OMAiGVTHMTP
    OrthoDBiEOG091G05F9
    PhylomeDBiQ86TI2
    TreeFamiTF313309

    Enzyme and pathway databases

    SABIO-RKiQ86TI2

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    DPP9 human

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    DPP9

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    91039

    Protein Ontology

    More...
    PROi
    PR:Q86TI2

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000142002 Expressed in 184 organ(s), highest expression level in skeletal muscle tissue
    ExpressionAtlasiQ86TI2 baseline and differential
    GenevisibleiQ86TI2 HS

    Family and domain databases

    Gene3Di2.140.10.30, 1 hit
    3.40.50.1820, 1 hit
    InterProiView protein in InterPro
    IPR029058 AB_hydrolase
    IPR001375 Peptidase_S9
    IPR002469 Peptidase_S9B_N
    IPR038554 Peptidase_S9B_N_sf
    PfamiView protein in Pfam
    PF00930 DPPIV_N, 1 hit
    PF00326 Peptidase_S9, 1 hit
    SUPFAMiSSF53474 SSF53474, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDPP9_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86TI2
    Secondary accession number(s): O75273
    , O75868, Q1ZZB8, Q6AI37, Q6UAL0, Q6ZMT2, Q6ZNJ5, Q8N2J7, Q8N3F5, Q8WXD8, Q96NT8, Q9BVR3
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
    Last sequence update: June 7, 2005
    Last modified: December 5, 2018
    This is version 146 of the entry and version 3 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    2. SIMILARITY comments
      Index of protein domains and families
    3. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    4. Peptidase families
      Classification of peptidase families and list of entries
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again