Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein hinderin

Gene

KIAA1328

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Competes with SMC1 for binding to SMC3. May affect the availability of SMC3 to engage in the formation of multimeric protein complexes.1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
Protein hinderin1 Publication
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

EuPathDBiHostDB:ENSG00000150477.14
HGNCiHGNC:29248 KIAA1328
MIMi616480 gene
neXtProtiNX_Q86T90

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000150477
PharmGKBiPA134875219

Polymorphism and mutation databases

BioMutaiKIAA1328
DMDMi296434548

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003122981 – 577Protein hinderinAdd BLAST577

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei21PhosphoserineBy similarity1
Modified residuei179PhosphoserineCombined sources1
Modified residuei490PhosphoserineCombined sources1
Modified residuei521PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ86T90
PaxDbiQ86T90
PeptideAtlasiQ86T90
PRIDEiQ86T90
ProteomicsDBi69669
69670 [Q86T90-2]
69671 [Q86T90-3]
69672 [Q86T90-4]

PTM databases

iPTMnetiQ86T90
PhosphoSitePlusiQ86T90

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000150477 Expressed in 134 organ(s), highest expression level in corpus callosum
CleanExiHS_KIAA1328
ExpressionAtlasiQ86T90 baseline and differential
GenevisibleiQ86T90 HS

Organism-specific databases

HPAiHPA040946

Interactioni

Subunit structurei

Interacts (via N- and C-terminal domains) with SMC3 (via central hinge region).1 Publication

Protein-protein interaction databases

BioGridi121595, 14 interactors
IntActiQ86T90, 41 interactors
STRINGi9606.ENSP00000280020

Structurei

3D structure databases

ProteinModelPortaliQ86T90
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili91 – 167Sequence analysisAdd BLAST77
Coiled coili358 – 402Sequence analysisAdd BLAST45

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IEB0 Eukaryota
ENOG4111J99 LUCA
GeneTreeiENSGT00390000011152
HOGENOMiHOG000168783
HOVERGENiHBG108034
InParanoidiQ86T90
OMAiNCLLKSN
PhylomeDBiQ86T90
TreeFamiTF332088

Family and domain databases

InterProiView protein in InterPro
IPR032736 Hinderin
PfamiView protein in Pfam
PF15369 KIAA1328, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86T90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADVAGPSRP SAAAFWSRDF SDEEQSVVYV PGISAEGNVR SRHKLMSPKA
60 70 80 90 100
DVKLKTSRVT DASISMESLK GTGDSVDEQN SCRGEIKSAS LKDLCLEDKR
110 120 130 140 150
RIANLIKELA RVSEEKEVTE ERLKAEQESF EKKIRQLEEQ NELIIKEREA
160 170 180 190 200
LQLQYRECQE LLSLYQKYLS EQQEKLTMSL SELGAARMQE QQVSSRKSTL
210 220 230 240 250
QCSSVELDGS YLSIARPQTY YQTKQRPKSA VQDSASESLI AFRNNSLKPV
260 270 280 290 300
TLHHPKDDLD KIPSETTTCN CESPGRKPAV PTEKMPQEEL HMKECPHLKP
310 320 330 340 350
TPSQCCGHRL AADRVHDSHP TNMTPQHPKT HPESCSYCRL SWASLVHGGG
360 370 380 390 400
ALQPIETLKK QISEDRKQQL MLQKMELEIE KERLQHLLAQ QETKLLLKQQ
410 420 430 440 450
QLHQSRLDYN CLLKSNCDGW LLGTSSSIKK HQDPPNSGEN RKERKTVGFH
460 470 480 490 500
SHMKDDAQWS CQKKDTCRPQ RGTVTGVRKD ASTSPMPTGS LKDFVTTASP
510 520 530 540 550
SLQHTTSRYE TSLLDLVQSL SPNSAPKPQR YPSREAGAWN HGTFRLSPLK
560 570
STRKKMGMHR TPEELEENQI LEDIFFI
Length:577
Mass (Da):65,373
Last modified:May 18, 2010 - v2
Checksum:i0B977577ECDD5FF4
GO
Isoform 2 (identifier: Q86T90-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MADVAGPSRPSAAAFWSRDF → MPDNIIVFSFMFSCVV

Note: No experimental confirmation available.
Show »
Length:573
Mass (Da):65,083
Checksum:iEEEED353DDDC1086
GO
Isoform 3 (identifier: Q86T90-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-284: Missing.
     411-411: C → WLKAQALFKSRELVAEKQLTKPQELKLDMNGSDSGPS
     509-527: YETSLLDLVQSLSPNSAPK → PGISTKICFLSNHFFILFS
     528-577: Missing.

Note: No experimental confirmation available.
Show »
Length:279
Mass (Da):31,620
Checksum:iD118E23F1E51E886
GO
Isoform 4 (identifier: Q86T90-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-284: Missing.
     412-413: LL → SE
     414-577: Missing.

Note: No experimental confirmation available.
Show »
Length:129
Mass (Da):14,978
Checksum:i05AD9DAE951A194C
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EJ61K7EJ61_HUMAN
Protein hinderin
KIAA1328
163Annotation score:
K7EM46K7EM46_HUMAN
Protein hinderin
KIAA1328
601Annotation score:
K7EP66K7EP66_HUMAN
Protein hinderin
KIAA1328
81Annotation score:
M0QYQ2M0QYQ2_HUMAN
Protein hinderin
KIAA1328
12Annotation score:

Sequence cautioni

The sequence BAA92566 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti62A → V in CAD89947 (PubMed:17974005).Curated1
Sequence conflicti76V → A in CAD89947 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_037483383R → C. Corresponds to variant dbSNP:rs12326301Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0298091 – 284Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST284
Alternative sequenceiVSP_0298101 – 20MADVA…WSRDF → MPDNIIVFSFMFSCVV in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_029811411C → WLKAQALFKSRELVAEKQLT KPQELKLDMNGSDSGPS in isoform 3. 1 Publication1
Alternative sequenceiVSP_029812412 – 413LL → SE in isoform 4. 1 Publication2
Alternative sequenceiVSP_029813414 – 577Missing in isoform 4. 1 PublicationAdd BLAST164
Alternative sequenceiVSP_029814509 – 527YETSL…NSAPK → PGISTKICFLSNHFFILFS in isoform 3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_029815528 – 577Missing in isoform 3. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037749 mRNA Translation: BAA92566.2 Different initiation.
AL832625 mRNA Translation: CAD89947.1
AC009854 Genomic DNA No translation available.
AC015961 Genomic DNA No translation available.
AC016493 Genomic DNA No translation available.
BC008670 mRNA Translation: AAH08670.1
BC037903 mRNA Translation: AAH37903.1
CCDSiCCDS45855.1 [Q86T90-1]
RefSeqiNP_065827.1, NM_020776.1 [Q86T90-1]
XP_005258374.1, XM_005258317.3 [Q86T90-2]
UniGeneiHs.4045
Hs.586976

Genome annotation databases

EnsembliENST00000280020; ENSP00000280020; ENSG00000150477 [Q86T90-1]
ENST00000586135; ENSP00000467507; ENSG00000150477 [Q86T90-3]
ENST00000586501; ENSP00000470371; ENSG00000150477 [Q86T90-4]
ENST00000591619; ENSP00000465550; ENSG00000150477 [Q86T90-2]
GeneIDi57536
KEGGihsa:57536
UCSCiuc002kzz.4 human [Q86T90-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037749 mRNA Translation: BAA92566.2 Different initiation.
AL832625 mRNA Translation: CAD89947.1
AC009854 Genomic DNA No translation available.
AC015961 Genomic DNA No translation available.
AC016493 Genomic DNA No translation available.
BC008670 mRNA Translation: AAH08670.1
BC037903 mRNA Translation: AAH37903.1
CCDSiCCDS45855.1 [Q86T90-1]
RefSeqiNP_065827.1, NM_020776.1 [Q86T90-1]
XP_005258374.1, XM_005258317.3 [Q86T90-2]
UniGeneiHs.4045
Hs.586976

3D structure databases

ProteinModelPortaliQ86T90
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121595, 14 interactors
IntActiQ86T90, 41 interactors
STRINGi9606.ENSP00000280020

PTM databases

iPTMnetiQ86T90
PhosphoSitePlusiQ86T90

Polymorphism and mutation databases

BioMutaiKIAA1328
DMDMi296434548

Proteomic databases

MaxQBiQ86T90
PaxDbiQ86T90
PeptideAtlasiQ86T90
PRIDEiQ86T90
ProteomicsDBi69669
69670 [Q86T90-2]
69671 [Q86T90-3]
69672 [Q86T90-4]

Protocols and materials databases

DNASUi57536
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000280020; ENSP00000280020; ENSG00000150477 [Q86T90-1]
ENST00000586135; ENSP00000467507; ENSG00000150477 [Q86T90-3]
ENST00000586501; ENSP00000470371; ENSG00000150477 [Q86T90-4]
ENST00000591619; ENSP00000465550; ENSG00000150477 [Q86T90-2]
GeneIDi57536
KEGGihsa:57536
UCSCiuc002kzz.4 human [Q86T90-1]

Organism-specific databases

CTDi57536
EuPathDBiHostDB:ENSG00000150477.14
GeneCardsiKIAA1328
HGNCiHGNC:29248 KIAA1328
HPAiHPA040946
MIMi616480 gene
neXtProtiNX_Q86T90
OpenTargetsiENSG00000150477
PharmGKBiPA134875219
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEB0 Eukaryota
ENOG4111J99 LUCA
GeneTreeiENSGT00390000011152
HOGENOMiHOG000168783
HOVERGENiHBG108034
InParanoidiQ86T90
OMAiNCLLKSN
PhylomeDBiQ86T90
TreeFamiTF332088

Miscellaneous databases

ChiTaRSiKIAA1328 human
GenomeRNAii57536
PROiPR:Q86T90
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000150477 Expressed in 134 organ(s), highest expression level in corpus callosum
CleanExiHS_KIAA1328
ExpressionAtlasiQ86T90 baseline and differential
GenevisibleiQ86T90 HS

Family and domain databases

InterProiView protein in InterPro
IPR032736 Hinderin
PfamiView protein in Pfam
PF15369 KIAA1328, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiK1328_HUMAN
AccessioniPrimary (citable) accession number: Q86T90
Secondary accession number(s): Q05DL0, Q49AG6, Q9P2L8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: May 18, 2010
Last modified: November 7, 2018
This is version 99 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again