Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 152 (02 Jun 2021)
Sequence version 1 (01 Jun 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Zinc finger protein 605

Gene

ZNF605

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri169 – 191C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri197 – 219C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri225 – 247C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri253 – 275C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri281 – 303C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri309 – 331C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri337 – 359C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri365 – 387C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri393 – 415C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri421 – 443C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri449 – 471C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri477 – 499C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri505 – 527C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri533 – 555C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri561 – 583C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri589 – 611C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri617 – 639C2H2-type 17PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q86T29

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-212436, Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 605
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF605
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28068, ZNF605

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86T29

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000196458.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000196458

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134901606

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q86T29, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF605

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74762445

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002345941 – 641Zinc finger protein 605Add BLAST641

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki77Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki391Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q86T29

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q86T29

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86T29

PeptideAtlas

More...
PeptideAtlasi
Q86T29

PRoteomics IDEntifications database

More...
PRIDEi
Q86T29

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
69662 [Q86T29-1]
69663 [Q86T29-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86T29

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86T29

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000196458, Expressed in sural nerve and 173 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86T29, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000196458, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
941286, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q86T29, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000376135

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q86T29, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86T29

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini6 – 77KRABPROSITE-ProRule annotationAdd BLAST72

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri169 – 191C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri197 – 219C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri225 – 247C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri253 – 275C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri281 – 303C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri309 – 331C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri337 – 359C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri365 – 387C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri393 – 415C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri421 – 443C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri449 – 471C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri477 – 499C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri505 – 527C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri533 – 555C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri561 – 583C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri589 – 611C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri617 – 639C2H2-type 17PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162586

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002678_44_5_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86T29

Identification of Orthologs from Complete Genome Data

More...
OMAi
KMWHQDN

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86T29

TreeFam database of animal gene trees

More...
TreeFami
TF350805

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07765, KRAB_A-box, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001909, KRAB
IPR036051, KRAB_dom_sf
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01352, KRAB, 1 hit
PF00096, zf-C2H2, 14 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00349, KRAB, 1 hit
SM00355, ZnF_C2H2, 17 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF109640, SSF109640, 1 hit
SSF57667, SSF57667, 9 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50805, KRAB, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 17 hits
PS50157, ZINC_FINGER_C2H2_2, 17 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q86T29-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIQSQISFED VAVDFTLEEW QLLNPTQKNL YRDVMLENYS NLVFLEVWLD
60 70 80 90 100
NPKMWLRDNQ DNLKSMERGH KYDVFGKIFN SSINIVHVGL RSHKCGTGEK
110 120 130 140 150
SLKCPFDLLI PKNNCERKKI DELNKKLLFC IKPGRTHGGI KYCDCSTCRK
160 170 180 190 200
SSNEEPWLTA NHITHTGVYL CMECGRFFNK KSQLVIHQRT HTGEKPYQCS
210 220 230 240 250
ECGKAFSQKS LLTVHQRTHS GEKPHGCSEC QKAFSRKSLL ILHQRIHTGE
260 270 280 290 300
KPYGCSECGK AFSRKSQLKR HQITHTIEKP YSCSECGKAF SQKLKLITHQ
310 320 330 340 350
RAHTGEKPYP CSHCGKAFFW KSQLITHQRT HTGKKPYGCG ECQKAFSRNS
360 370 380 390 400
LLIRHQRIHT GEKPYECNEC GEAFIRKPQL IKHQITHTGE KNYRCSDCEE
410 420 430 440 450
AFFKKSELIR HQKIHLGEKP YGCIQCGKTF FGKSQLLTHH RTHTGEKPYE
460 470 480 490 500
CSECGKAFTQ KSSLISHQRT HTGEKPYECS ECRKTFSEKS SLIHHQRTHT
510 520 530 540 550
GEKPFECSEC RKAFAWKPQL LRHQRIHTGE KPYECSECGK AFVQKVQLIK
560 570 580 590 600
HQRNHTGEKT YGCSDCAKAF FEKAQLIIHQ RIHTGERPYK CGECGKSFTR
610 620 630 640
KSHLMRHQRI HTGDKYYGCN ECGTTFNRKS QLMIHQRNHI I
Length:641
Mass (Da):74,376
Last modified:June 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i473B29D31BA84F9C
GO
Isoform 2 (identifier: Q86T29-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-45: L → LGFQILKPDAMFKLEQQDPWIIGQEILNQNFS

Show »
Length:672
Mass (Da):78,007
Checksum:iC502A7DE92303B85
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti580Q → R in CAD89946 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04321345L → LGFQILKPDAMFKLEQQDPW IIGQEILNQNFS in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK122878 mRNA Translation: BAG53776.1
AL832191 mRNA Translation: CAD91163.1
AL832623 mRNA Translation: CAD89946.1
AC073911 Genomic DNA No translation available.
AC127070 Genomic DNA No translation available.
CH471218 Genomic DNA Translation: EAW54805.1
CH471218 Genomic DNA Translation: EAW54806.1
CH471218 Genomic DNA Translation: EAW54807.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31938.1 [Q86T29-1]
CCDS53850.1 [Q86T29-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001158187.1, NM_001164715.1 [Q86T29-2]
NP_899061.1, NM_183238.3 [Q86T29-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000360187; ENSP00000353314; ENSG00000196458 [Q86T29-1]
ENST00000392321; ENSP00000376135; ENSG00000196458 [Q86T29-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100289635

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:100289635

UCSC genome browser

More...
UCSCi
uc001ulh.4, human [Q86T29-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122878 mRNA Translation: BAG53776.1
AL832191 mRNA Translation: CAD91163.1
AL832623 mRNA Translation: CAD89946.1
AC073911 Genomic DNA No translation available.
AC127070 Genomic DNA No translation available.
CH471218 Genomic DNA Translation: EAW54805.1
CH471218 Genomic DNA Translation: EAW54806.1
CH471218 Genomic DNA Translation: EAW54807.1
CCDSiCCDS31938.1 [Q86T29-1]
CCDS53850.1 [Q86T29-2]
RefSeqiNP_001158187.1, NM_001164715.1 [Q86T29-2]
NP_899061.1, NM_183238.3 [Q86T29-1]

3D structure databases

SMRiQ86T29
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi941286, 1 interactor
IntActiQ86T29, 1 interactor
STRINGi9606.ENSP00000376135

PTM databases

iPTMnetiQ86T29
PhosphoSitePlusiQ86T29

Genetic variation databases

BioMutaiZNF605
DMDMi74762445

Proteomic databases

MassIVEiQ86T29
MaxQBiQ86T29
PaxDbiQ86T29
PeptideAtlasiQ86T29
PRIDEiQ86T29
ProteomicsDBi69662 [Q86T29-1]
69663 [Q86T29-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
56779, 68 antibodies

The DNASU plasmid repository

More...
DNASUi
100289635

Genome annotation databases

EnsembliENST00000360187; ENSP00000353314; ENSG00000196458 [Q86T29-1]
ENST00000392321; ENSP00000376135; ENSG00000196458 [Q86T29-2]
GeneIDi100289635
KEGGihsa:100289635
UCSCiuc001ulh.4, human [Q86T29-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
100289635

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF605
HGNCiHGNC:28068, ZNF605
HPAiENSG00000196458, Low tissue specificity
neXtProtiNX_Q86T29
OpenTargetsiENSG00000196458
PharmGKBiPA134901606
VEuPathDBiHostDB:ENSG00000196458.10

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721, Eukaryota
GeneTreeiENSGT00940000162586
HOGENOMiCLU_002678_44_5_1
InParanoidiQ86T29
OMAiKMWHQDN
OrthoDBi1318335at2759
PhylomeDBiQ86T29
TreeFamiTF350805

Enzyme and pathway databases

PathwayCommonsiQ86T29
ReactomeiR-HSA-212436, Generic Transcription Pathway

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
100289635, 3 hits in 989 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZNF605, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
100289635
PharosiQ86T29, Tdark

Protein Ontology

More...
PROi
PR:Q86T29
RNActiQ86T29, protein

Gene expression databases

BgeeiENSG00000196458, Expressed in sural nerve and 173 other tissues
GenevisibleiQ86T29, HS

Family and domain databases

CDDicd07765, KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909, KRAB
IPR036051, KRAB_dom_sf
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type
PfamiView protein in Pfam
PF01352, KRAB, 1 hit
PF00096, zf-C2H2, 14 hits
SMARTiView protein in SMART
SM00349, KRAB, 1 hit
SM00355, ZnF_C2H2, 17 hits
SUPFAMiSSF109640, SSF109640, 1 hit
SSF57667, SSF57667, 9 hits
PROSITEiView protein in PROSITE
PS50805, KRAB, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 17 hits
PS50157, ZINC_FINGER_C2H2_2, 17 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN605_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86T29
Secondary accession number(s): B3KVG4, D3DXJ0, Q86T91
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: June 1, 2003
Last modified: June 2, 2021
This is version 152 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again