Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (07 Oct 2020)
Sequence version 2 (29 Apr 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tubulin epsilon and delta complex protein 1

Gene

TEDC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a positive regulator of ciliary hedgehog signaling. Required for centriole stability (By similarity). May play a role in counteracting perturbation of actin filaments, such as after treatment with the actin depolymerizing microbial metabolite Chivosazole F (PubMed:28796488).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q86SX3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tubulin epsilon and delta complex protein 1Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TEDC1Imported
Synonyms:C14orf80Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000185347.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20127, TEDC1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86SX3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
283643

Open Targets

More...
OpenTargetsi
ENSG00000185347

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134885988

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q86SX3, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TEDC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
187470846

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003306921 – 495Tubulin epsilon and delta complex protein 1Add BLAST495

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q86SX3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86SX3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q86SX3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q86SX3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86SX3

PeptideAtlas

More...
PeptideAtlasi
Q86SX3

PRoteomics IDEntifications database

More...
PRIDEi
Q86SX3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
19061
6174
69642 [Q86SX3-1]
69643 [Q86SX3-2]
69644 [Q86SX3-3]
69645 [Q86SX3-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86SX3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86SX3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000185347, Expressed in tendon of biceps brachii and 140 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q86SX3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86SX3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000185347, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TEDC2.

Found in a complex with TEDC1, TEDC2, TUBE1 and TUBD1.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
129629, 27 interactors

Database of interacting proteins

More...
DIPi
DIP-62062N

Protein interaction database and analysis system

More...
IntActi
Q86SX3, 21 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000376307

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q86SX3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86SX3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili355 – 387Sequence analysisAdd BLAST33
Coiled coili452 – 480Sequence analysisAdd BLAST29

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502RXA4, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000011474

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_052124_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86SX3

Identification of Orthologs from Complete Genome Data

More...
OMAi
SCTPGMG

Database of Orthologous Groups

More...
OrthoDBi
1248596at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86SX3

TreeFam database of animal gene trees

More...
TreeFami
TF330945

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027996, DUF4509
IPR028100, DUF4510
IPR043535, TEDC1

The PANTHER Classification System

More...
PANTHERi
PTHR35076, PTHR35076, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14970, DUF4509, 1 hit
PF14971, DUF4510, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86SX3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGRRRQRVDP AAGARAGALP EAIAALSRSL PSGPSPEIFR RAKFDRPEAT
60 70 80 90 100
SALWQLLFRV LSPLPAGNAL ASLALEVQAR LVKSALCSQG YPRLALAQLP
110 120 130 140 150
EDGSQGSREL LLALSWLLAR GPVPEQMLAQ ARVPLGDEMT VCQCEALASP
160 170 180 190 200
GPPAPHMEAE GPVDVRHVQW LMGKLRFRWR QLVSSQQEQC ALLSKIHLYT
210 220 230 240 250
RGCHSDQSLS HLSVTEAEML RDPEGGQQVS GAGAAQNLDL AYPKCLHSFC
260 270 280 290 300
TPGMGPRTFW NDLWLVCEQP GLLPGDWAAP LDPGGASACS LLSPFRALLR
310 320 330 340 350
TLERENQRLE AVLAWRRSEL VFWRWMDTVL GTCAPEVPAA ASQPTFLPWV
360 370 380 390 400
PERGGGELDL VVRELQALEE ELREAAERRR AAWEAKAGGC GRGPEWSAAR
410 420 430 440 450
RASREAVEKE LGALQQCWER DGGPAQPHGP HRLVRREDGA AGDRDLRAAV
460 470 480 490
VIRTLRSQEA CLEAVLRRLQ GQCRQELARL VGARPGLIWI PPPGR
Length:495
Mass (Da):54,231
Last modified:April 29, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3E34FACE82E0EACF
GO
Isoform 2 (identifier: Q86SX3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-297: Missing.

Show »
Length:393
Mass (Da):43,354
Checksum:i631EE5AEFA077F5E
GO
Isoform 3 (identifier: Q86SX3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MGRRRQRVDPAAGARAGALPEAIAALSRSLPSGPSPEIFRRAKFDRPEA → MSGQRGDWVQ
     196-297: Missing.

Show »
Length:354
Mass (Da):39,259
Checksum:i007C4A3DF6F200CB
GO
Isoform 4 (identifier: Q86SX3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-126: Missing.
     144-195: Missing.
     229-297: Missing.

Show »
Length:248
Mass (Da):27,737
Checksum:i322285EC56B4EBDC
GO
Isoform 5 (identifier: Q86SX3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MGRRRQRVDPAAGARAGALPEAIAALSRSLPSGPSPEIFRRAKFDRPEA → MSGQRGDW
     196-297: Missing.

Show »
Length:352
Mass (Da):39,032
Checksum:i5C79B45957535B4E
GO
Isoform 6 (identifier: Q86SX3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-297: Missing.

Show »
Length:426
Mass (Da):47,032
Checksum:iB9DB7727EAAAAA39
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9IYA4C9IYA4_HUMAN
Tubulin epsilon and delta complex p...
TEDC1
302Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9K0G6C9K0G6_HUMAN
Tubulin epsilon and delta complex p...
TEDC1
216Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J317C9J317_HUMAN
Tubulin epsilon and delta complex p...
TEDC1
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J6B2C9J6B2_HUMAN
Tubulin epsilon and delta complex p...
TEDC1
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J1F2C9J1F2_HUMAN
Tubulin epsilon and delta complex p...
TEDC1
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JZ80C9JZ80_HUMAN
Tubulin epsilon and delta complex p...
TEDC1
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VP51F8VP51_HUMAN
Tubulin epsilon and delta complex p...
TEDC1
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAD62351 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence CAD62363 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence CAD62611 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0330621 – 126Missing in isoform 4. 1 PublicationAdd BLAST126
Alternative sequenceiVSP_0330631 – 49MGRRR…DRPEA → MSGQRGDWVQ in isoform 3. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_0456901 – 49MGRRR…DRPEA → MSGQRGDW in isoform 5. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_033064144 – 195Missing in isoform 4. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_033065196 – 297Missing in isoform 2, isoform 3 and isoform 5. 1 PublicationAdd BLAST102
Alternative sequenceiVSP_033066229 – 297Missing in isoform 4 and isoform 6. 1 PublicationAdd BLAST69

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BX161477 mRNA Translation: CAD61932.1
BX248038 mRNA Translation: CAD62351.1 Different initiation.
BX248074 mRNA Translation: CAD62363.1 Different initiation.
BX248283 mRNA Translation: CAD62611.1 Different initiation.
AL928654 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81929.1
BC016028 mRNA Translation: AAH16028.1
AK024506 mRNA Translation: BAB15796.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45180.1 [Q86SX3-5]
CCDS45181.1 [Q86SX3-6]
CCDS45182.1 [Q86SX3-2]
CCDS55955.1 [Q86SX3-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001128347.1, NM_001134875.1 [Q86SX3-6]
NP_001128348.1, NM_001134876.1 [Q86SX3-2]
NP_001128349.1, NM_001134877.1 [Q86SX3-5]
NP_001185912.1, NM_001198983.1 [Q86SX3-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000329886; ENSP00000333010; ENSG00000185347 [Q86SX3-3]
ENST00000334656; ENSP00000333959; ENSG00000185347 [Q86SX3-4]
ENST00000354560; ENSP00000346568; ENSG00000185347 [Q86SX3-2]
ENST00000392522; ENSP00000376307; ENSG00000185347 [Q86SX3-6]
ENST00000392523; ENSP00000376308; ENSG00000185347 [Q86SX3-1]
ENST00000392527; ENSP00000376312; ENSG00000185347 [Q86SX3-5]
ENST00000450383; ENSP00000391436; ENSG00000185347 [Q86SX3-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
283643

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:283643

UCSC genome browser

More...
UCSCi
uc001yrj.4, human [Q86SX3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX161477 mRNA Translation: CAD61932.1
BX248038 mRNA Translation: CAD62351.1 Different initiation.
BX248074 mRNA Translation: CAD62363.1 Different initiation.
BX248283 mRNA Translation: CAD62611.1 Different initiation.
AL928654 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81929.1
BC016028 mRNA Translation: AAH16028.1
AK024506 mRNA Translation: BAB15796.1
CCDSiCCDS45180.1 [Q86SX3-5]
CCDS45181.1 [Q86SX3-6]
CCDS45182.1 [Q86SX3-2]
CCDS55955.1 [Q86SX3-3]
RefSeqiNP_001128347.1, NM_001134875.1 [Q86SX3-6]
NP_001128348.1, NM_001134876.1 [Q86SX3-2]
NP_001128349.1, NM_001134877.1 [Q86SX3-5]
NP_001185912.1, NM_001198983.1 [Q86SX3-3]

3D structure databases

SMRiQ86SX3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi129629, 27 interactors
DIPiDIP-62062N
IntActiQ86SX3, 21 interactors
STRINGi9606.ENSP00000376307

PTM databases

iPTMnetiQ86SX3
PhosphoSitePlusiQ86SX3

Polymorphism and mutation databases

BioMutaiTEDC1
DMDMi187470846

Proteomic databases

EPDiQ86SX3
jPOSTiQ86SX3
MassIVEiQ86SX3
MaxQBiQ86SX3
PaxDbiQ86SX3
PeptideAtlasiQ86SX3
PRIDEiQ86SX3
ProteomicsDBi19061
6174
69642 [Q86SX3-1]
69643 [Q86SX3-2]
69644 [Q86SX3-3]
69645 [Q86SX3-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
48308, 51 antibodies

The DNASU plasmid repository

More...
DNASUi
283643

Genome annotation databases

EnsembliENST00000329886; ENSP00000333010; ENSG00000185347 [Q86SX3-3]
ENST00000334656; ENSP00000333959; ENSG00000185347 [Q86SX3-4]
ENST00000354560; ENSP00000346568; ENSG00000185347 [Q86SX3-2]
ENST00000392522; ENSP00000376307; ENSG00000185347 [Q86SX3-6]
ENST00000392523; ENSP00000376308; ENSG00000185347 [Q86SX3-1]
ENST00000392527; ENSP00000376312; ENSG00000185347 [Q86SX3-5]
ENST00000450383; ENSP00000391436; ENSG00000185347 [Q86SX3-4]
GeneIDi283643
KEGGihsa:283643
UCSCiuc001yrj.4, human [Q86SX3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
283643
DisGeNETi283643
EuPathDBiHostDB:ENSG00000185347.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TEDC1
HGNCiHGNC:20127, TEDC1
HPAiENSG00000185347, Low tissue specificity
neXtProtiNX_Q86SX3
OpenTargetsiENSG00000185347
PharmGKBiPA134885988

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502RXA4, Eukaryota
GeneTreeiENSGT00390000011474
HOGENOMiCLU_052124_0_0_1
InParanoidiQ86SX3
OMAiSCTPGMG
OrthoDBi1248596at2759
PhylomeDBiQ86SX3
TreeFamiTF330945

Enzyme and pathway databases

PathwayCommonsiQ86SX3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
283643, 346 hits in 879 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
283643
PharosiQ86SX3, Tdark

Protein Ontology

More...
PROi
PR:Q86SX3
RNActiQ86SX3, protein

Gene expression databases

BgeeiENSG00000185347, Expressed in tendon of biceps brachii and 140 other tissues
ExpressionAtlasiQ86SX3, baseline and differential
GenevisibleiQ86SX3, HS

Family and domain databases

InterProiView protein in InterPro
IPR027996, DUF4509
IPR028100, DUF4510
IPR043535, TEDC1
PANTHERiPTHR35076, PTHR35076, 1 hit
PfamiView protein in Pfam
PF14970, DUF4509, 1 hit
PF14971, DUF4510, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTEDC1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86SX3
Secondary accession number(s): B5MDG3
, E9PAQ4, Q86TT3, Q86TT4, Q86TT5, Q96B41, Q9H7H4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: April 29, 2008
Last modified: October 7, 2020
This is version 121 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again