Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lysozyme g-like protein 2

Gene

LYG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May act as a potent antibacterial protein that may play a role in the innate immunity.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei105By similarity1

GO - Molecular functioni

  • lysozyme activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionGlycosidase, Hydrolase

Enzyme and pathway databases

BRENDAi3.2.1.17 2681

Protein family/group databases

CAZyiGH23 Glycoside Hydrolase Family 23

Names & Taxonomyi

Protein namesi
Recommended name:
Lysozyme g-like protein 2 (EC:3.2.1.-)
Gene namesi
Name:LYG2
Synonyms:LYGH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000185674.9
HGNCiHGNC:29615 LYG2
MIMi616547 gene
neXtProtiNX_Q86SG7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000185674
PharmGKBiPA162394717

Polymorphism and mutation databases

BioMutaiLYG2
DMDMi47117209

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000001202520 – 212Lysozyme g-like protein 2Add BLAST193

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi39 ↔ 92By similarity
Disulfide bondi53 ↔ 61By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ86SG7
PeptideAtlasiQ86SG7
PRIDEiQ86SG7
ProteomicsDBi69589

PTM databases

iPTMnetiQ86SG7
PhosphoSitePlusiQ86SG7

Expressioni

Tissue specificityi

Strong expression detected in the eye and weak expression in the testis. No expression is observed in any other tissues.1 Publication

Gene expression databases

BgeeiENSG00000185674 Expressed in 82 organ(s), highest expression level in buccal mucosa cell
CleanExiHS_LYG2
ExpressionAtlasiQ86SG7 baseline and differential
GenevisibleiQ86SG7 HS

Organism-specific databases

HPAiHPA039179

Interactioni

Protein-protein interaction databases

BioGridi129047, 28 interactors
IntActiQ86SG7, 1 interactor
STRINGi9606.ENSP00000327533

Structurei

3D structure databases

ProteinModelPortaliQ86SG7
SMRiQ86SG7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyl hydrolase 23 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IJVN Eukaryota
ENOG4111M7T LUCA
GeneTreeiENSGT00390000017614
HOGENOMiHOG000247036
HOVERGENiHBG006299
InParanoidiQ86SG7
OMAiGDIMTME
OrthoDBiEOG091G0LPR
PhylomeDBiQ86SG7
TreeFamiTF329826

Family and domain databases

CDDicd01021 GEWL, 1 hit
InterProiView protein in InterPro
IPR002152 Glyco_hydro_23
IPR023346 Lysozyme-like_dom_sf
PIRSFiPIRSF001065 Lysozyme_g, 1 hit
PRINTSiPR00749 LYSOZYMEG
SUPFAMiSSF53955 SSF53955, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86SG7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLSSVVFWGL IALIGTSRGS YPFSHSMKPH LHPRLYHGCY GDIMTMKTSG
60 70 80 90 100
ATCDANSVMN CGIRGSEMFA EMDLRAIKPY QTLIKEVGQR HCVDPAVIAA
110 120 130 140 150
IISRESHGGS VLQDGWDHRG LKFGLMQLDK QTYHPVGAWD SKEHLSQATG
160 170 180 190 200
ILTERIKAIQ KKFPTWSVAQ HLKGGLSAFK SGIEAIATPS DIDNDFVNDI
210
IARAKFYKRQ SF
Length:212
Mass (Da):23,498
Last modified:May 10, 2004 - v2
Checksum:iF1D36C905373D625
GO
Isoform 2 (identifier: Q86SG7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-212: GLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF → FFLL

Note: No experimental confirmation available.
Show »
Length:178
Mass (Da):19,830
Checksum:i779CB5CBE192AC10
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J4J0C9J4J0_HUMAN
Lysozyme g-like protein
LYG2 hCG_38422
182Annotation score:
C9JBA4C9JBA4_HUMAN
Lysozyme g-like protein 2
LYG2
169Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti8W → G in AAK16605 (Ref. 4) Curated1
Sequence conflicti8W → G in AAO32945 (Ref. 4) Curated1
Sequence conflicti19G → S in AAK16605 (Ref. 4) Curated1
Sequence conflicti19G → S in AAO32945 (Ref. 4) Curated1
Sequence conflicti55A → P in AAK16605 (Ref. 4) Curated1
Sequence conflicti55A → P in AAO32945 (Ref. 4) Curated1
Sequence conflicti175 – 182GLSAFKSG → RLYSEYFY (Ref. 4) Curated8

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056329175 – 212GLSAF…KRQSF → FFLL in isoform 2. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY026238 mRNA Translation: AAK16605.1
AC079447 Genomic DNA Translation: AAX93255.1
BC100882 mRNA Translation: AAI00883.1
BC100883 mRNA Translation: AAI00884.1
BC100884 mRNA Translation: AAI00885.1
BC100885 mRNA Translation: AAI00886.1
AF323919 mRNA Translation: AAO32945.1
CCDSiCCDS2042.1 [Q86SG7-1]
RefSeqiNP_783862.2, NM_175735.3 [Q86SG7-1]
XP_016859240.1, XM_017003751.1 [Q86SG7-1]
UniGeneiHs.436468

Genome annotation databases

EnsembliENST00000333017; ENSP00000327533; ENSG00000185674 [Q86SG7-1]
ENST00000409238; ENSP00000386939; ENSG00000185674 [Q86SG7-1]
ENST00000423800; ENSP00000390357; ENSG00000185674 [Q86SG7-2]
ENST00000626374; ENSP00000487012; ENSG00000185674 [Q86SG7-2]
GeneIDi254773
KEGGihsa:254773
UCSCiuc002szw.2 human [Q86SG7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY026238 mRNA Translation: AAK16605.1
AC079447 Genomic DNA Translation: AAX93255.1
BC100882 mRNA Translation: AAI00883.1
BC100883 mRNA Translation: AAI00884.1
BC100884 mRNA Translation: AAI00885.1
BC100885 mRNA Translation: AAI00886.1
AF323919 mRNA Translation: AAO32945.1
CCDSiCCDS2042.1 [Q86SG7-1]
RefSeqiNP_783862.2, NM_175735.3 [Q86SG7-1]
XP_016859240.1, XM_017003751.1 [Q86SG7-1]
UniGeneiHs.436468

3D structure databases

ProteinModelPortaliQ86SG7
SMRiQ86SG7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129047, 28 interactors
IntActiQ86SG7, 1 interactor
STRINGi9606.ENSP00000327533

Protein family/group databases

CAZyiGH23 Glycoside Hydrolase Family 23

PTM databases

iPTMnetiQ86SG7
PhosphoSitePlusiQ86SG7

Polymorphism and mutation databases

BioMutaiLYG2
DMDMi47117209

Proteomic databases

PaxDbiQ86SG7
PeptideAtlasiQ86SG7
PRIDEiQ86SG7
ProteomicsDBi69589

Protocols and materials databases

DNASUi254773
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000333017; ENSP00000327533; ENSG00000185674 [Q86SG7-1]
ENST00000409238; ENSP00000386939; ENSG00000185674 [Q86SG7-1]
ENST00000423800; ENSP00000390357; ENSG00000185674 [Q86SG7-2]
ENST00000626374; ENSP00000487012; ENSG00000185674 [Q86SG7-2]
GeneIDi254773
KEGGihsa:254773
UCSCiuc002szw.2 human [Q86SG7-1]

Organism-specific databases

CTDi254773
EuPathDBiHostDB:ENSG00000185674.9
GeneCardsiLYG2
HGNCiHGNC:29615 LYG2
HPAiHPA039179
MIMi616547 gene
neXtProtiNX_Q86SG7
OpenTargetsiENSG00000185674
PharmGKBiPA162394717
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJVN Eukaryota
ENOG4111M7T LUCA
GeneTreeiENSGT00390000017614
HOGENOMiHOG000247036
HOVERGENiHBG006299
InParanoidiQ86SG7
OMAiGDIMTME
OrthoDBiEOG091G0LPR
PhylomeDBiQ86SG7
TreeFamiTF329826

Enzyme and pathway databases

BRENDAi3.2.1.17 2681

Miscellaneous databases

GenomeRNAii254773
PROiPR:Q86SG7
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000185674 Expressed in 82 organ(s), highest expression level in buccal mucosa cell
CleanExiHS_LYG2
ExpressionAtlasiQ86SG7 baseline and differential
GenevisibleiQ86SG7 HS

Family and domain databases

CDDicd01021 GEWL, 1 hit
InterProiView protein in InterPro
IPR002152 Glyco_hydro_23
IPR023346 Lysozyme-like_dom_sf
PIRSFiPIRSF001065 Lysozyme_g, 1 hit
PRINTSiPR00749 LYSOZYMEG
SUPFAMiSSF53955 SSF53955, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiLYG2_HUMAN
AccessioniPrimary (citable) accession number: Q86SG7
Secondary accession number(s): Q496G2, Q53RW0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: September 12, 2018
This is version 112 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again