Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein lingerer

Gene

lig

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts in the nervous system to mediate the control of copulatory organs during courtship.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • copulation Source: FlyBase
  • dorsal/ventral axis specification, ovarian follicular epithelium Source: FlyBase
  • male mating behavior Source: FlyBase
  • negative regulation of imaginal disc growth Source: FlyBase
  • negative regulation of JAK-STAT cascade Source: FlyBase
  • positive regulation of transcription, DNA-templated Source: FlyBase

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processBehavior

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein lingerer
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ligImported
ORF Names:CG8715
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0020279 lig

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Male flies exhibit abnormal copulation. They fail to successfully withdraw their genitalia upon termination of copulation so end up 'stuck' to the female, tugging to separate. There is also a "non-copulating" behavioral phenotype. There are no morphological defects in the male genitalia. Females can mate successfully but have reduced fertility. Complete loss of lig function results in lethality during early pupal stages.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003146211 – 1375Protein lingererAdd BLAST1375

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei321Phosphotyrosine1 Publication1
Modified residuei324Phosphoserine1 Publication1
Modified residuei672Phosphoserine1 Publication1
Modified residuei673Phosphothreonine1 Publication1
Modified residuei674Phosphoserine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86S05

PRoteomics IDEntifications database

More...
PRIDEi
Q86S05

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86S05

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

At stage 11, expression is restricted to the neuroblasts, predominant in the central nervous system (CNS), including the brain and ventral nerve cord, and in the PNS. Later embryonic expression is seen in the gonads. Late third instar larvae show expression in the CNS, imaginal disks (including genital, eye-antennal, leg, wing and haltere disks), and gonads. In the larval brain, it is expressed in all of the glial cells and in clusters of neurons that projected contralaterally. In the larval ventral ganglion, it is expressed in subperineurial glia, peripheral exit glia, and a number of interneurons, but not in motor neurons. Isoform B is abundantly expressed in males and females. Isoform D is male specific and expressed at low levels.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed both maternally and zygotically throughout development. Zygotic expression levels rise after embryonic stage 9.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0020279 Expressed in 31 organ(s), highest expression level in embryo

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q86S05 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
61631, 21 interactors

Protein interaction database and analysis system

More...
IntActi
Q86S05, 2 interactors

Molecular INTeraction database

More...
MINTi
Q86S05

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0303481

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q86S05

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86S05

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini84 – 124UBASequence analysisAdd BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi226 – 282Gly-richSequence analysisAdd BLAST57
Compositional biasi629 – 678Gln-richSequence analysisAdd BLAST50
Compositional biasi881 – 1038Gly-richSequence analysisAdd BLAST158

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGWX Eukaryota
ENOG4110RI8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003453

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86S05

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0EFG

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86S05

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022166 DUF3697_Uba2
IPR009060 UBA-like_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12478 DUF3697, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46934 SSF46934, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform D1 Publication (identifier: Q86S05-1) [UniParc]FASTAAdd to basket
Also known as: Lig-B1 Publication, type21 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTQTRSGGG GGGGHARNQK KSNASNSGGG GTGHHDGVSH AAAAGKKGGQ
60 70 80 90 100
DASKTDKPEK AQPKATTEQL RIAQITNSTT EDPQINEKVL LLLTMTQRSE
110 120 130 140 150
EEVCCALNEC DYDLEAAANF LIEELPQGAF AKYEKKRKNK AANNTADGAA
160 170 180 190 200
GDGDWADGNG NADRREKSRN RSSNRGGTRG SSDSRGWRGR ETRENERNQR
210 220 230 240 250
ESREPWSGQN AGQDRGDDRA NDNYRGQRNG GGRSGPGGGG RGGGFVSRSG
260 270 280 290 300
RGGGRMGGRT GGPRGDRGSG GPGGAYGSGR GGNANEDHHE VELWDNTIAQ
310 320 330 340 350
NAEKQQQAHD DAWGDWNNEE YEGSLKDSKV FTTSNLATQS AANVVSGTGA
360 370 380 390 400
SVTAVPAAAG TEISAPPGLE HQLVQQGSHL EESSSSGPAA VTPPATLSGS
410 420 430 440 450
ATTPLLQYSA AVSNPPPQLQ SQGTQSGAGT GASAAAGGGA GSTPSSFVSA
460 470 480 490 500
SPDTFSSAAS AAATLVHQAQ KQQQLQQQTT PIKPSATLSV EQSQYFNSLA
510 520 530 540 550
SQGVSPGSVP VQSAPAGYAQ NPVAAYSQTS TSVGVSQYPN TYANVFASGT
560 570 580 590 600
AAGAGTAEQS QQQPQIRRAR VKLPPPSKIP ASAVEMPGDN ALNNIGYLDV
610 620 630 640 650
QFGALDFGTD DGFEPLPEKV GSGFSIDGQQ QQQQPDDYQS KSQQQQQVTL
660 670 680 690 700
AAGLQSSQIS DALNAAGYTS RSTSQQQQGV SSAVNATIDQ LTKSDPYGQT
710 720 730 740 750
GGSGNAYQNA YQSSGASKTA SGFPTTAPGG YSSSTYANVQ SSVANSYQQQ
760 770 780 790 800
GYGSYQPSSY QQQAGSGAQS GTGAVSGGGG TATQNIPVGG SSSQNSTSGN
810 820 830 840 850
ASSAYLTSGY STPQSAYQSS QSVYGNTGLS NSSGFSGSAS NASSQYANFS
860 870 880 890 900
ASAKLKDATT ASSAAHYDSV STSSGVSSNS GSTGNGGVVS GQTGANQAAV
910 920 930 940 950
SNNNSVSGSS SVSNVTAGVA SGNVAGVGGG VSQSGVSSGV GVPGGSASSV
960 970 980 990 1000
GVNVNNNSSS ASSVGAATVA QTATGTTAAV LASLTNKNTS SSNSSGSGGS
1010 1020 1030 1040 1050
AATTTGNASG QGAGASTGGV GSSSGAGGAG SGGGSGSGLV PTNIQMVSQY
1060 1070 1080 1090 1100
IQTGLPYYQQ PVYSYEELQM MQQRVPHVQG YYDLNYPPAS LGAGRDNLGS
1110 1120 1130 1140 1150
VTYSAMNDGR FARTDNNSSP VGNVSSTMSQ QAGSSAPMLN VPYAYFYGGN
1160 1170 1180 1190 1200
VMPGSFQYGT PAIYPQIPAA NTASGQQFPK PSYSAGYGST SYDTLSQTTQ
1210 1220 1230 1240 1250
DYSKGGYSSS VNQQSKTQTV SNQSQAGTGS DLTSSMYGKG HVALNKVNSY
1260 1270 1280 1290 1300
EKQSFHSGTP PPFNMPNTQT AGGTSAQPYG MYLPMPAAGH HNMIHQPIHQ
1310 1320 1330 1340 1350
VHSELPLQVV VGGGTESHVL IHGNVNGPQV TYHRIWQTEP VQCQNQLVAA
1360 1370
HCNNFEPNID CCVHDNNNDL SFFAD
Length:1,375
Mass (Da):139,491
Last modified:June 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5FE3204D18FDE70A
GO
Isoform A1 Publication (identifier: Q86S05-2) [UniParc]FASTAAdd to basket
Also known as: C1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1301-1375: VHSELPLQVV...NNNDLSFFAD → MDGRIHSSSR...YSPSYWAGQN

Note: No experimental confirmation available.Curated
Show »
Length:1,343
Mass (Da):135,845
Checksum:i63CF1A76DE780CFA
GO
Isoform B1 Publication (identifier: Q86S05-3) [UniParc]FASTAAdd to basket
Also known as: Lig-A1 Publication, type11 Publication, type31 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1301-1375: VHSELPLQVV...NNNDLSFFAD → DSNSAGQRQQSTSQSKSAGKQGYSPSYWAGQN

Show »
Length:1,332
Mass (Da):134,561
Checksum:iF1E59F730B014024
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4K6T1A0A0B4K6T1_DROME
Lingerer, isoform I
lig CG8715, Dmel\CG8715, CG8715, Dmel_CG8715
1,300Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4K7U5A0A0B4K7U5_DROME
Lingerer, isoform H
lig CG8715, Dmel\CG8715, CG8715, Dmel_CG8715
1,330Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D0Z768D0Z768_DROME
Lingerer, isoform J
lig Dmel\CG8715, lig-RA, CG8715, Dmel_CG8715
1,079Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KFC5A0A0B4KFC5_DROME
Lingerer, isoform K
lig CG8715, Dmel\CG8715, CG8715, Dmel_CG8715
1,417Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A126GUM8A0A126GUM8_DROME
Lingerer, isoform L
lig CG8715, Dmel\CG8715, CG8715, Dmel_CG8715
1,261Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E1JH02E1JH02_DROME
Lingerer, isoform E
lig Dmel\CG8715, CG8715, Dmel_CG8715
1,332Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti185R → C in AAO23022 (PubMed:12524348).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0526331301 – 1375VHSEL…SFFAD → MDGRIHSSSRRDSNSAGQRQ QSTSQSKSAGKQGYSPSYWA GQN in isoform A. 1 PublicationAdd BLAST75
Alternative sequenceiVSP_0526341301 – 1375VHSEL…SFFAD → DSNSAGQRQQSTSQSKSAGK QGYSPSYWAGQN in isoform B. 2 PublicationsAdd BLAST75

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF276963 mRNA Translation: AAO23022.1
AF276964 mRNA Translation: AAO23023.1
AE013599 Genomic DNA Translation: AAF59144.3
AE013599 Genomic DNA Translation: AAM68848.2
AE013599 Genomic DNA Translation: AAS64895.2
AE013599 Genomic DNA Translation: AAX52724.1
AY069682 mRNA Translation: AAL39827.1

NCBI Reference Sequences

More...
RefSeqi
NP_001014503.1, NM_001014503.2 [Q86S05-1]
NP_001163081.1, NM_001169610.2 [Q86S05-3]
NP_001163082.1, NM_001169611.1 [Q86S05-3]
NP_001163083.1, NM_001169612.2 [Q86S05-3]
NP_610348.3, NM_136504.5 [Q86S05-2]
NP_724643.2, NM_165586.5 [Q86S05-3]
NP_995778.2, NM_206056.5 [Q86S05-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Dm.517

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0088774; FBpp0087852; FBgn0020279 [Q86S05-2]
FBtr0088775; FBpp0087853; FBgn0020279 [Q86S05-3]
FBtr0088776; FBpp0087854; FBgn0020279 [Q86S05-2]
FBtr0100575; FBpp0100030; FBgn0020279 [Q86S05-1]
FBtr0301915; FBpp0291129; FBgn0020279 [Q86S05-3]
FBtr0301916; FBpp0291130; FBgn0020279 [Q86S05-3]
FBtr0301917; FBpp0291131; FBgn0020279 [Q86S05-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
35771

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG8715

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF276963 mRNA Translation: AAO23022.1
AF276964 mRNA Translation: AAO23023.1
AE013599 Genomic DNA Translation: AAF59144.3
AE013599 Genomic DNA Translation: AAM68848.2
AE013599 Genomic DNA Translation: AAS64895.2
AE013599 Genomic DNA Translation: AAX52724.1
AY069682 mRNA Translation: AAL39827.1
RefSeqiNP_001014503.1, NM_001014503.2 [Q86S05-1]
NP_001163081.1, NM_001169610.2 [Q86S05-3]
NP_001163082.1, NM_001169611.1 [Q86S05-3]
NP_001163083.1, NM_001169612.2 [Q86S05-3]
NP_610348.3, NM_136504.5 [Q86S05-2]
NP_724643.2, NM_165586.5 [Q86S05-3]
NP_995778.2, NM_206056.5 [Q86S05-2]
UniGeneiDm.517

3D structure databases

ProteinModelPortaliQ86S05
SMRiQ86S05
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi61631, 21 interactors
IntActiQ86S05, 2 interactors
MINTiQ86S05
STRINGi7227.FBpp0303481

PTM databases

iPTMnetiQ86S05

Proteomic databases

PaxDbiQ86S05
PRIDEiQ86S05

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0088774; FBpp0087852; FBgn0020279 [Q86S05-2]
FBtr0088775; FBpp0087853; FBgn0020279 [Q86S05-3]
FBtr0088776; FBpp0087854; FBgn0020279 [Q86S05-2]
FBtr0100575; FBpp0100030; FBgn0020279 [Q86S05-1]
FBtr0301915; FBpp0291129; FBgn0020279 [Q86S05-3]
FBtr0301916; FBpp0291130; FBgn0020279 [Q86S05-3]
FBtr0301917; FBpp0291131; FBgn0020279 [Q86S05-3]
GeneIDi35771
KEGGidme:Dmel_CG8715

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
35771
FlyBaseiFBgn0020279 lig

Phylogenomic databases

eggNOGiENOG410IGWX Eukaryota
ENOG4110RI8 LUCA
GeneTreeiENSGT00390000003453
InParanoidiQ86S05
OrthoDBiEOG091G0EFG
PhylomeDBiQ86S05

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
lig fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
35771

Protein Ontology

More...
PROi
PR:Q86S05

Gene expression databases

BgeeiFBgn0020279 Expressed in 31 organ(s), highest expression level in embryo
ExpressionAtlasiQ86S05 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR022166 DUF3697_Uba2
IPR009060 UBA-like_sf
PfamiView protein in Pfam
PF12478 DUF3697, 1 hit
SUPFAMiSSF46934 SSF46934, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLIG_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86S05
Secondary accession number(s): A1Z794, Q86S06, Q8SZZ7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: June 1, 2003
Last modified: September 12, 2018
This is version 115 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again