Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Formin-like protein 5

Gene

FH5

Organism
Oryza sativa subsp. japonica (Rice)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei127Phosphocysteine intermediatePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Formin-like protein 5
Alternative name(s):
OsFH5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FH5
Ordered Locus Names:Os07g0596300, LOC_Os07g40510/LOC_Os07g40520
ORF Names:P0453E05.107
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiOryza sativa subsp. japonica (Rice)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri39947 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaLiliopsidaPoalesPoaceaeBOP cladeOryzoideaeOryzeaeOryzinaeOryzaOryza sativa
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000059680 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003190091 – 1627Formin-like protein 5Add BLAST1627

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q84ZL0

PRoteomics IDEntifications database

More...
PRIDEi
Q84ZL0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q84ZL0 differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q84ZL0 OS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
39947.LOC_Os07g40520.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q84ZL0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q84ZL0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini5 – 194Phosphatase tensin-typePROSITE-ProRule annotationAdd BLAST190
Domaini200 – 337C2 tensin-typePROSITE-ProRule annotationAdd BLAST138
Domaini1188 – 1588FH2PROSITE-ProRule annotationAdd BLAST401

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi825 – 1170Pro-richAdd BLAST346

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the formin-like family. Class-II subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1922 Eukaryota
ENOG410XQR0 LUCA

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q84ZL0

Database of Orthologous Groups

More...
OrthoDBi
1204639at2759

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.90.190.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015425 FH2_Formin
IPR029021 Prot-tyrosine_phosphatase-like
IPR014020 Tensin_C2-dom
IPR029023 Tensin_phosphatase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02181 FH2, 1 hit
PF10409 PTEN_C2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00498 FH2, 1 hit
SM01326 PTEN_C2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52799 SSF52799, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51182 C2_TENSIN, 1 hit
PS51444 FH2, 1 hit
PS51181 PPASE_TENSIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q84ZL0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALFRKFFLK KTPDRLLEIS ERVYVFDCCF STDSMGEDEY RDYLSGIVAQ
60 70 80 90 100
LQDYFPDASF MVSNFWSGDK RSRISDILSE YDMTVMDYPQ QYEGCPLLQL
110 120 130 140 150
EMIHHFLKSC ENWLSVEGQH NMLLMHCERG GWPVLAFMLA GLLLYRKTYT
160 170 180 190 200
GEQKTLEMVY KQARRDFIQQ FFPLNPQSSH MRYLHYITRQ GSGPEKPPIS
210 220 230 240 250
RPLILDSIVL HVVPRFDAEG GCRPYLRVHG QDSSSSNKSA KVLYEMPKTK
260 270 280 290 300
KHLQRYGQAE VPVKVGAFCR VQGDVVLECI HIGDNLDHEE IMFRVMFNTA
310 320 330 340 350
FIQSNILGLN RDDIDVSWNS NNQFPRDFRA EVVFSDPGSF KPAAATVEEV
360 370 380 390 400
DDDGDETDVA SVDTGEEFYE AEEDWHDARR DPETQSTDGR TSIGDAELDG
410 420 430 440 450
GVSREDSGSL EKHRADEDVK IVISQNLGCM SDRPVSAPAE ILGNPGGLQQ
460 470 480 490 500
ACENEEMPKL SNRSDQDDNA VQDIQVVAAS VDSEGHKFGS ICQKEDMKGV
510 520 530 540 550
IAQTLVTAID PSCSDEVQCQ PDESAKILKY PNLDYTGFSS PRTLSSVDED
560 570 580 590 600
TRLGTIPNVA LQNADVKIIT ESTVIVDNEL VIYEEKTIVD NGNLTQEVKN
610 620 630 640 650
VVNEESTTPK LDRSVIESVD SQDNKNHKME VAKAADTTDS KMEQTKLKSG
660 670 680 690 700
LEDAISLKKT TVQGSIVVLP ATEIATKIKT KREESGGRRD VGISLPQSKI
710 720 730 740 750
EARAKSPRIS SDRRQIPDKV VPSKKMPVDH APEAVLLEEK LGNSDQSQEQ
760 770 780 790 800
PKAVKPKTVR RWISPNKESE TTSVHRPSHP PSRYDSSPAA LAIHSMHTNN
810 820 830 840 850
KFNVGKDAPL VSSGAQAVPK IQAAPPPPPP PPPPYASSSS LSMHMGSATK
860 870 880 890 900
QQPPPPPPPP PLPPPPPPPA SSGLSSIPPP PPPPPLMSFG AQTRTFVPPP
910 920 930 940 950
PPPPPPPRSG VGGNTPPAPP PPPLRSTVPA ISPPPPPPPP PLKPSSGAPC
960 970 980 990 1000
PPPPPPPPPP PPPSAPSSRA FSSAPPPPPP PPLLRSVPPP PPPPPISHSN
1010 1020 1030 1040 1050
APPPPPLPAA RFNAPPPPPP PPTTHFNAPP PPPPPPITRS GAPPSPPPPP
1060 1070 1080 1090 1100
SPPPPPPPPG ARPGPPPPPP PPGARPGPPP PPPPPGGRPS APPLPPPGGR
1110 1120 1130 1140 1150
ASAPPPPPPP STRLGAPPPP PPPGAGGRAP PPPPAPGGRL GGPPPPPPPG
1160 1170 1180 1190 1200
GRAPPPPRGP GAPPPPGGNP SSLIGRGRGV VRASGSGFGA AAARKSTLKP
1210 1220 1230 1240 1250
LHWIKVTRAL QGSLWEELQR NDDSQSVSEF DLSELESLFP AAVPKPNDSS
1260 1270 1280 1290 1300
KSDSRRKSLG SKPEKVHLIE LRRANNTEIM LTKVKMPLPD LVSAALALDQ
1310 1320 1330 1340 1350
STLDVDQVEN LIKFCPTKEE MELLKNYTGD KENLGKCEQF FLELMKVPRM
1360 1370 1380 1390 1400
ESKLRVFSFK IQFGSQVADL RKSLNTIDSS CDEIRSSLKL KEIMKKILLL
1410 1420 1430 1440 1450
GNTLNQGTAR GAAVGFRLDS LLKLTDTRAT NNKMTLMHYL CKVLAAKSSQ
1460 1470 1480 1490 1500
LLDFYMDLVS LEATSKIQLK MLAEEMQAVS KGLEKVQLEY NASESDGPVS
1510 1520 1530 1540 1550
EIFREKLKEF TDNAGADVQS LSSLFSEVGK KADALIKYFG EDPVRCPFEQ
1560 1570 1580 1590 1600
VISTLLTFVT MFRKAHEENR KQAELDKKRA EKEAEAEKSK AQLASKNDSK
1610 1620
PSNPSRQVKQ TPDTKTRAAS RRGKDVG
Length:1,627
Mass (Da):176,353
Last modified:February 26, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0158A7C3E49490AA
GO
Isoform 2 (identifier: Q84ZL0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1598-1627: DSKPSNPSRQVKQTPDTKTRAASRRGKDVG → VLILDLYLWQLQPTSYIHRIYKIQNLLTGL

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:1,627
Mass (Da):176,714
Checksum:i9490EC693EA78FA4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0P0X8E4A0A0P0X8E4_ORYSJ
Formin-like protein
Os07g0596300, OSNPB_070596300
741Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAF22085 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti935P → R in AK120222 (PubMed:12869764).Curated1
Sequence conflicti1260Missing in AK120222 (PubMed:12869764).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0313401598 – 1627DSKPS…GKDVG → VLILDLYLWQLQPTSYIHRI YKIQNLLTGL in isoform 2. CuratedAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AP004275 Genomic DNA Translation: BAC55695.1
AP008213 Genomic DNA Translation: BAF22085.2 Sequence problems.
AP014963 Genomic DNA No translation available.
AK120222 mRNA No translation available.

NCBI Reference Sequences

More...
RefSeqi
XP_015646968.1, XM_015791482.1 [Q84ZL0-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Os.59143

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
Os07t0596300-02; Os07t0596300-02; Os07g0596300 [Q84ZL0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4343793

Gramene; a comparative resource for plants

More...
Gramenei
Os07t0596300-02; Os07t0596300-02; Os07g0596300 [Q84ZL0-1]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
osa:4343793

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AP004275 Genomic DNA Translation: BAC55695.1
AP008213 Genomic DNA Translation: BAF22085.2 Sequence problems.
AP014963 Genomic DNA No translation available.
AK120222 mRNA No translation available.
RefSeqiXP_015646968.1, XM_015791482.1 [Q84ZL0-1]
UniGeneiOs.59143

3D structure databases

ProteinModelPortaliQ84ZL0
SMRiQ84ZL0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi39947.LOC_Os07g40520.1

Proteomic databases

PaxDbiQ84ZL0
PRIDEiQ84ZL0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiOs07t0596300-02; Os07t0596300-02; Os07g0596300 [Q84ZL0-1]
GeneIDi4343793
GrameneiOs07t0596300-02; Os07t0596300-02; Os07g0596300 [Q84ZL0-1]
KEGGiosa:4343793

Phylogenomic databases

eggNOGiKOG1922 Eukaryota
ENOG410XQR0 LUCA
InParanoidiQ84ZL0
OrthoDBi1204639at2759

Gene expression databases

ExpressionAtlasiQ84ZL0 differential
GenevisibleiQ84ZL0 OS

Family and domain databases

Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR015425 FH2_Formin
IPR029021 Prot-tyrosine_phosphatase-like
IPR014020 Tensin_C2-dom
IPR029023 Tensin_phosphatase
PfamiView protein in Pfam
PF02181 FH2, 1 hit
PF10409 PTEN_C2, 1 hit
SMARTiView protein in SMART
SM00498 FH2, 1 hit
SM01326 PTEN_C2, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS51182 C2_TENSIN, 1 hit
PS51444 FH2, 1 hit
PS51181 PPASE_TENSIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFH5_ORYSJ
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q84ZL0
Secondary accession number(s): Q0D4Y8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: January 16, 2019
This is version 95 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Oryza sativa (rice)
    Index of Oryza sativa entries and their corresponding gene designations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again