Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Formin-like protein 5

Gene

FH5

Organism
Oryza sativa subsp. japonica (Rice)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei127Phosphocysteine intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

Keywordsi

Molecular functionHydrolase, Protein phosphatase

Names & Taxonomyi

Protein namesi
Recommended name:
Formin-like protein 5
Alternative name(s):
OsFH5
Gene namesi
Name:FH5
Ordered Locus Names:Os07g0596300, LOC_Os07g40510/LOC_Os07g40520
ORF Names:P0453E05.107
OrganismiOryza sativa subsp. japonica (Rice)
Taxonomic identifieri39947 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaLiliopsidaPoalesPoaceaeBOP cladeOryzoideaeOryzeaeOryzinaeOryzaOryza sativa
Proteomesi
  • UP000059680 Componenti: Chromosome 7

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003190091 – 1627Formin-like protein 5Add BLAST1627

Proteomic databases

PaxDbiQ84ZL0
PRIDEiQ84ZL0

Expressioni

Gene expression databases

ExpressionAtlasiQ84ZL0 differential
GenevisibleiQ84ZL0 OS

Interactioni

Protein-protein interaction databases

STRINGi39947.LOC_Os07g40520.1

Structurei

3D structure databases

ProteinModelPortaliQ84ZL0
SMRiQ84ZL0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini5 – 194Phosphatase tensin-typePROSITE-ProRule annotationAdd BLAST190
Domaini200 – 337C2 tensin-typePROSITE-ProRule annotationAdd BLAST138
Domaini1188 – 1588FH2PROSITE-ProRule annotationAdd BLAST401

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi825 – 1170Pro-richAdd BLAST346

Sequence similaritiesi

Belongs to the formin-like family. Class-II subfamily.Curated

Phylogenomic databases

eggNOGiKOG1922 Eukaryota
ENOG410XQR0 LUCA
InParanoidiQ84ZL0
OrthoDBiEOG093601HE

Family and domain databases

Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR015425 FH2_Formin
IPR029021 Prot-tyrosine_phosphatase-like
IPR014020 Tensin_C2-dom
IPR029023 Tensin_phosphatase
PfamiView protein in Pfam
PF02181 FH2, 1 hit
PF10409 PTEN_C2, 1 hit
SMARTiView protein in SMART
SM00498 FH2, 1 hit
SM01326 PTEN_C2, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS51182 C2_TENSIN, 1 hit
PS51444 FH2, 1 hit
PS51181 PPASE_TENSIN, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q84ZL0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALFRKFFLK KTPDRLLEIS ERVYVFDCCF STDSMGEDEY RDYLSGIVAQ
60 70 80 90 100
LQDYFPDASF MVSNFWSGDK RSRISDILSE YDMTVMDYPQ QYEGCPLLQL
110 120 130 140 150
EMIHHFLKSC ENWLSVEGQH NMLLMHCERG GWPVLAFMLA GLLLYRKTYT
160 170 180 190 200
GEQKTLEMVY KQARRDFIQQ FFPLNPQSSH MRYLHYITRQ GSGPEKPPIS
210 220 230 240 250
RPLILDSIVL HVVPRFDAEG GCRPYLRVHG QDSSSSNKSA KVLYEMPKTK
260 270 280 290 300
KHLQRYGQAE VPVKVGAFCR VQGDVVLECI HIGDNLDHEE IMFRVMFNTA
310 320 330 340 350
FIQSNILGLN RDDIDVSWNS NNQFPRDFRA EVVFSDPGSF KPAAATVEEV
360 370 380 390 400
DDDGDETDVA SVDTGEEFYE AEEDWHDARR DPETQSTDGR TSIGDAELDG
410 420 430 440 450
GVSREDSGSL EKHRADEDVK IVISQNLGCM SDRPVSAPAE ILGNPGGLQQ
460 470 480 490 500
ACENEEMPKL SNRSDQDDNA VQDIQVVAAS VDSEGHKFGS ICQKEDMKGV
510 520 530 540 550
IAQTLVTAID PSCSDEVQCQ PDESAKILKY PNLDYTGFSS PRTLSSVDED
560 570 580 590 600
TRLGTIPNVA LQNADVKIIT ESTVIVDNEL VIYEEKTIVD NGNLTQEVKN
610 620 630 640 650
VVNEESTTPK LDRSVIESVD SQDNKNHKME VAKAADTTDS KMEQTKLKSG
660 670 680 690 700
LEDAISLKKT TVQGSIVVLP ATEIATKIKT KREESGGRRD VGISLPQSKI
710 720 730 740 750
EARAKSPRIS SDRRQIPDKV VPSKKMPVDH APEAVLLEEK LGNSDQSQEQ
760 770 780 790 800
PKAVKPKTVR RWISPNKESE TTSVHRPSHP PSRYDSSPAA LAIHSMHTNN
810 820 830 840 850
KFNVGKDAPL VSSGAQAVPK IQAAPPPPPP PPPPYASSSS LSMHMGSATK
860 870 880 890 900
QQPPPPPPPP PLPPPPPPPA SSGLSSIPPP PPPPPLMSFG AQTRTFVPPP
910 920 930 940 950
PPPPPPPRSG VGGNTPPAPP PPPLRSTVPA ISPPPPPPPP PLKPSSGAPC
960 970 980 990 1000
PPPPPPPPPP PPPSAPSSRA FSSAPPPPPP PPLLRSVPPP PPPPPISHSN
1010 1020 1030 1040 1050
APPPPPLPAA RFNAPPPPPP PPTTHFNAPP PPPPPPITRS GAPPSPPPPP
1060 1070 1080 1090 1100
SPPPPPPPPG ARPGPPPPPP PPGARPGPPP PPPPPGGRPS APPLPPPGGR
1110 1120 1130 1140 1150
ASAPPPPPPP STRLGAPPPP PPPGAGGRAP PPPPAPGGRL GGPPPPPPPG
1160 1170 1180 1190 1200
GRAPPPPRGP GAPPPPGGNP SSLIGRGRGV VRASGSGFGA AAARKSTLKP
1210 1220 1230 1240 1250
LHWIKVTRAL QGSLWEELQR NDDSQSVSEF DLSELESLFP AAVPKPNDSS
1260 1270 1280 1290 1300
KSDSRRKSLG SKPEKVHLIE LRRANNTEIM LTKVKMPLPD LVSAALALDQ
1310 1320 1330 1340 1350
STLDVDQVEN LIKFCPTKEE MELLKNYTGD KENLGKCEQF FLELMKVPRM
1360 1370 1380 1390 1400
ESKLRVFSFK IQFGSQVADL RKSLNTIDSS CDEIRSSLKL KEIMKKILLL
1410 1420 1430 1440 1450
GNTLNQGTAR GAAVGFRLDS LLKLTDTRAT NNKMTLMHYL CKVLAAKSSQ
1460 1470 1480 1490 1500
LLDFYMDLVS LEATSKIQLK MLAEEMQAVS KGLEKVQLEY NASESDGPVS
1510 1520 1530 1540 1550
EIFREKLKEF TDNAGADVQS LSSLFSEVGK KADALIKYFG EDPVRCPFEQ
1560 1570 1580 1590 1600
VISTLLTFVT MFRKAHEENR KQAELDKKRA EKEAEAEKSK AQLASKNDSK
1610 1620
PSNPSRQVKQ TPDTKTRAAS RRGKDVG
Length:1,627
Mass (Da):176,353
Last modified:February 26, 2008 - v2
Checksum:i0158A7C3E49490AA
GO
Isoform 2 (identifier: Q84ZL0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1598-1627: DSKPSNPSRQVKQTPDTKTRAASRRGKDVG → VLILDLYLWQLQPTSYIHRIYKIQNLLTGL

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:1,627
Mass (Da):176,714
Checksum:i9490EC693EA78FA4
GO

Sequence cautioni

The sequence BAF22085 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti935P → R in AK120222 (PubMed:12869764).Curated1
Sequence conflicti1260Missing in AK120222 (PubMed:12869764).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0313401598 – 1627DSKPS…GKDVG → VLILDLYLWQLQPTSYIHRI YKIQNLLTGL in isoform 2. CuratedAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AP004275 Genomic DNA Translation: BAC55695.1
AP008213 Genomic DNA Translation: BAF22085.2 Sequence problems.
AP014963 Genomic DNA No translation available.
AK120222 mRNA No translation available.
RefSeqiXP_015646968.1, XM_015791482.1 [Q84ZL0-1]
UniGeneiOs.59143

Genome annotation databases

EnsemblPlantsiOs07t0596300-01; Os07t0596300-01; Os07g0596300
Os07t0596300-02; Os07t0596300-02; Os07g0596300 [Q84ZL0-1]
GeneIDi4343793
GrameneiOs07t0596300-01; Os07t0596300-01; Os07g0596300
Os07t0596300-02; Os07t0596300-02; Os07g0596300 [Q84ZL0-1]
KEGGiosa:4343793

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFH5_ORYSJ
AccessioniPrimary (citable) accession number: Q84ZL0
Secondary accession number(s): Q0D4Y8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: May 23, 2018
This is version 93 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Oryza sativa (rice)
    Index of Oryza sativa entries and their corresponding gene designations
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health