Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (16 Oct 2019)
Sequence version 2 (13 Jun 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Disrupted in schizophrenia 1 homolog

Gene

Disc1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the regulation of multiple aspects of embryonic and adult neurogenesis. Required for neural progenitor proliferation in the ventrical/subventrical zone during embryonic brain development and in the adult dentate gyrus of the hippocampus. Participates in the Wnt-mediated neural progenitor proliferation as a positive regulator by modulating GSK3B activity and CTNNB1 abundance. Plays a role as a modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of newborn neurons integration during adult neurogenesis, including neuron positioning, dendritic development and synapse formation. Inhibits the activation of AKT-mTOR signaling upon interaction with CCDC88A. Regulates the migration of early-born granule cell precursors toward the dentate gyrus during the hippocampal development. Plays a role, together with PCNT, in the microtubule network formation.4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processNeurogenesis, Wnt signaling pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disrupted in schizophrenia 1 homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Disc1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2447658 Disc1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Microtubule, Mitochondrion, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Loss of function of DISC1 in the dentate gyrus of adult mice results in reduced neural progenitor cell proliferation and the appearance of schizophrenic and depressive-like behaviors.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002402301 – 852Disrupted in schizophrenia 1 homologAdd BLAST852

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated. Ubiquitination with 'Lys-48'-linked polyubiquitin chains leads to its proteasomal degradation.By similarity

Keywords - PTMi

Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q811T9

PRoteomics IDEntifications database

More...
PRIDEi
Q811T9

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q811T9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q811T9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in granule cell precursors within the dentate migratory stream during the first week of postnatal life and in differentiated granule cells of the hippocampus (at protein level). Detected in heart, brain, kidney, and testis (PubMed:12504857). Expressed in dentate gyrus, hippocampus and in the olfactory bulb.3 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in neuronal progenitors residing in the ventricular and subventriculare zones and in postmitotic neurons in the cortical plate of the cerebral cortex at 15 dpc. Expressed in granule cell precursors within the dentate migratory stream of the hippocampus at 19 dpc (at protein level).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000043051 Expressed in 34 organ(s), highest expression level in cerebral cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q811T9 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with NDEL1 (PubMed:14962739).

Interacts with CCDC88A (via C-terminus); the interaction is direct (PubMed:19778506).

Interacts with GSK3B (PubMed:19303846).

Interacts with tubulin alpha, ACTN2, ANKHD1, ATF4, ATF5, CEP63, EIF3S3, MAP1A, NDEL1, PAFAH1B1, RANBP9, SPTBN4, SYNE1 and TRAF3IP1. Interaction with microtubules may be mediated in part by TRAF3IP1.

Interacts (via C-terminal) with PCNT.

Interacts with CHCHD6 (By similarity).

Interacts with CCDC141 (PubMed:20956536).

Interacts with FBXW7, the substrate-recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex; the interaction targets DISC1 for proteasomal degradation (By similarity).

Interacts with ZNF365 (By similarity).

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
232675, 2 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q811T9

Database of interacting proteins

More...
DIPi
DIP-54914N

Protein interaction database and analysis system

More...
IntActi
Q811T9, 8 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000112410

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1852
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q811T9

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 294Interaction with MAP1ABy similarityAdd BLAST294
Regioni295 – 693Interaction with TRAF3IP1By similarityAdd BLAST399
Regioni437 – 594Required for localization to punctate cytoplasmic fociBy similarityAdd BLAST158
Regioni443 – 852Necessary and sufficient for interaction with PCNT and localization at the centrosomeBy similarityAdd BLAST410
Regioni595 – 852Interaction with ATF4 and ATF5By similarityAdd BLAST258
Regioni728 – 852Interaction with NDEL1 and PAFAH1B1By similarityAdd BLAST125
Regioni728 – 852Interaction with PAFAH1B1By similarityAdd BLAST125
Regioni802 – 835Interaction with NDEL1By similarityAdd BLAST34

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili367 – 397Sequence analysisAdd BLAST31
Coiled coili449 – 496Sequence analysisAdd BLAST48

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IG23 Eukaryota
ENOG41122J7 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000006176

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000056668

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q811T9

KEGG Orthology (KO)

More...
KOi
K16534

Identification of Orthologs from Complete Genome Data

More...
OMAi
HPEDGCS

Database of Orthologous Groups

More...
OrthoDBi
254709at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q811T9

TreeFam database of animal gene trees

More...
TreeFami
TF332357

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026081 DISC1

The PANTHER Classification System

More...
PANTHERi
PTHR14332 PTHR14332, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q811T9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQGGGPRGAP IHSPSHGADS GHGLPPAVAP QRRRLTRRPG YMRSTAGSGI
60 70 80 90 100
GFLSPAVGMP HPSSAGLTGQ QSQHSQSKAG QCGLDPGSHC QASLVGKPFL
110 120 130 140 150
KSSLVPAVAS EGHLHPAQRS MRKRPVHFAV HSKNDSRQSE RLTGSFKPGD
160 170 180 190 200
SGFWQELLSS DSFKSLAPSL DAPWNKGSRG LKTVKPLASP ALNGPADIAS
210 220 230 240 250
LPGFQDTFTS SFSFIQLSLG AAGERGEAEG CLPSREAEPL HQRPQEMAAE
260 270 280 290 300
ASSSDRPHGD PRHLWTFSLH AAPGLADLAQ VTRSSSRQSE CGTVSSSSSD
310 320 330 340 350
TGFSSQDASS AGGRGDQGGG WADAHGWHTL LREWEPMLQD YLLSNRRQLE
360 370 380 390 400
VTSLILKLQK CQEKVVEDGD YDTAETLRQR LEELEQEKGR LSWALPSQQP
410 420 430 440 450
ALRSFLGYLA AQIQVALHGA TQRAGSDDPE APLEGQLRTT AQDSLPASIT
460 470 480 490 500
RRDWLIREKQ RLQKEIEALQ ARMSALEAKE KRLSQELEEQ EVLLRWPGCD
510 520 530 540 550
LMALVAQMSP GQLQEVSKAL GETLTSANQA PFQVEPPETL RSLRERTKSL
560 570 580 590 600
NLAVRELTAQ VCSGEKLCSS LRRRLSDLDT RLPALLEAKM LALSGSCFST
610 620 630 640 650
AKELTEEIWA LSSEREGLEM FLGRLLALSS RNSRRLGIVK EDHLRCRQDL
660 670 680 690 700
ALQDAAHKTR MKANTVKCME VLEGQLSSCR CPLLGRVWKA DLETCQLLMQ
710 720 730 740 750
SLQLQEAGSS PHAEDEEQVH STGEAAQTAA LAVPRTPHPE EEKSPLQVLQ
760 770 780 790 800
EWDTHSALSP HCAAGPWKED SHIVSAEVGE KCEAIGVKLL HLEDQLLGAM
810 820 830 840 850
YSHDEALFQS LQGELQTVKE TLQAMILQLQ PTKEAGEASA SYPTAGAQET

EA
Length:852
Mass (Da):92,525
Last modified:June 13, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB55A850B15028E6F
GO
Isoform 2 (identifier: Q811T9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQGGGPRGAPIHSPSHGA → MEAENSSWLTLPCLLY

Note: No experimental confirmation available.
Show »
Length:850
Mass (Da):92,681
Checksum:i04E0133A67BC4B2E
GO
Isoform 3 (identifier: Q811T9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     595-658: GSCFSTAKELTEEIWALSSEREGLEMFLGRLLALSSRNSRRLGIVKEDHLRCRQDLALQDAAHK → E

Note: No experimental confirmation available.
Show »
Length:789
Mass (Da):85,428
Checksum:iC2EE115DF618732D
GO
Isoform 4 (identifier: Q811T9-4) [UniParc]FASTAAdd to basket
Also known as: ES

The sequence of this isoform differs from the canonical sequence as follows:
     374-387: AETLRQRLEELEQE → GESKAVRRQFHLSP
     388-852: Missing.

Show »
Length:387
Mass (Da):41,115
Checksum:i066544374E3C8790
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YYC9D3YYC9_MOUSE
Disrupted in schizophrenia 1 homolo...
Disc1
852Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Z4YLG9Z4YLG9_MOUSE
Disrupted in schizophrenia 1 homolo...
Disc1
789Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti8G → D in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti8G → D in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti120S → F in AAO19641 (PubMed:12506198).Curated1
Sequence conflicti120S → F in AAP83943 (PubMed:12506198).Curated1
Sequence conflicti129A → G in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti129A → G in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti141R → K in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti141R → K in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti153F → C in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti153F → C in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti176K → T in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti176K → T in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti190P → S in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti190P → S in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti199A → P in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti199A → P in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti289S → P in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti289S → P in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti295Missing in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti295Missing in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti302G → V in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti302G → V in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti365V → A in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti365V → A in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti390R → H in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti390R → H in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti441A → T in CAD44629 (PubMed:12573262).Curated1
Sequence conflicti461R → Q in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti461R → Q in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti474S → Y in CAD44629 (PubMed:12573262).Curated1
Sequence conflicti533Q → H in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti533Q → H in AAN77092 (PubMed:12504857).Curated1
Sequence conflicti639V → L in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti643H → Y in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti788K → R in AAN77091 (PubMed:12504857).Curated1
Sequence conflicti788K → R in AAN77092 (PubMed:12504857).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0193181 – 18MQGGG…PSHGA → MEAENSSWLTLPCLLY in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_019319374 – 387AETLR…ELEQE → GESKAVRRQFHLSP in isoform 4. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_019320388 – 852Missing in isoform 4. 1 PublicationAdd BLAST465
Alternative sequenceiVSP_019321595 – 658GSCFS…DAAHK → E in isoform 3. 1 PublicationAdd BLAST64

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF513723 mRNA Translation: AAN77091.1
AF513724 mRNA Translation: AAN77092.1
AJ506179 mRNA Translation: CAD44629.1
AJ506180 mRNA Translation: CAD44630.1
AY177673 mRNA Translation: AAO19641.1
AY320287 mRNA Translation: AAP83943.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS40517.1 [Q811T9-3]
CCDS52707.1 [Q811T9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_777278.2, NM_174853.2 [Q811T9-3]
NP_777279.2, NM_174854.2 [Q811T9-1]
XP_011246690.1, XM_011248388.2 [Q811T9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000075730; ENSMUSP00000075145; ENSMUSG00000043051 [Q811T9-3]
ENSMUST00000098311; ENSMUSP00000095914; ENSMUSG00000043051 [Q811T9-1]
ENSMUST00000117658; ENSMUSP00000112757; ENSMUSG00000043051 [Q811T9-3]
ENSMUST00000118942; ENSMUSP00000112410; ENSMUSG00000043051 [Q811T9-1]
ENSMUST00000121953; ENSMUSP00000112929; ENSMUSG00000043051 [Q811T9-2]
ENSMUST00000122389; ENSMUSP00000112593; ENSMUSG00000043051 [Q811T9-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
244667

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:244667

UCSC genome browser

More...
UCSCi
uc009nyb.1 mouse [Q811T9-4]
uc009nyc.1 mouse [Q811T9-1]
uc009nyd.1 mouse [Q811T9-3]
uc012gnb.1 mouse [Q811T9-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF513723 mRNA Translation: AAN77091.1
AF513724 mRNA Translation: AAN77092.1
AJ506179 mRNA Translation: CAD44629.1
AJ506180 mRNA Translation: CAD44630.1
AY177673 mRNA Translation: AAO19641.1
AY320287 mRNA Translation: AAP83943.1
CCDSiCCDS40517.1 [Q811T9-3]
CCDS52707.1 [Q811T9-1]
RefSeqiNP_777278.2, NM_174853.2 [Q811T9-3]
NP_777279.2, NM_174854.2 [Q811T9-1]
XP_011246690.1, XM_011248388.2 [Q811T9-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5YI4NMR-A765-852[»]
SMRiQ811T9
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi232675, 2 interactors
CORUMiQ811T9
DIPiDIP-54914N
IntActiQ811T9, 8 interactors
STRINGi10090.ENSMUSP00000112410

PTM databases

iPTMnetiQ811T9
PhosphoSitePlusiQ811T9

Proteomic databases

PaxDbiQ811T9
PRIDEiQ811T9

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
244667

Genome annotation databases

EnsembliENSMUST00000075730; ENSMUSP00000075145; ENSMUSG00000043051 [Q811T9-3]
ENSMUST00000098311; ENSMUSP00000095914; ENSMUSG00000043051 [Q811T9-1]
ENSMUST00000117658; ENSMUSP00000112757; ENSMUSG00000043051 [Q811T9-3]
ENSMUST00000118942; ENSMUSP00000112410; ENSMUSG00000043051 [Q811T9-1]
ENSMUST00000121953; ENSMUSP00000112929; ENSMUSG00000043051 [Q811T9-2]
ENSMUST00000122389; ENSMUSP00000112593; ENSMUSG00000043051 [Q811T9-4]
GeneIDi244667
KEGGimmu:244667
UCSCiuc009nyb.1 mouse [Q811T9-4]
uc009nyc.1 mouse [Q811T9-1]
uc009nyd.1 mouse [Q811T9-3]
uc012gnb.1 mouse [Q811T9-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
27185
MGIiMGI:2447658 Disc1

Phylogenomic databases

eggNOGiENOG410IG23 Eukaryota
ENOG41122J7 LUCA
GeneTreeiENSGT00390000006176
HOGENOMiHOG000056668
InParanoidiQ811T9
KOiK16534
OMAiHPEDGCS
OrthoDBi254709at2759
PhylomeDBiQ811T9
TreeFamiTF332357

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Disc1 mouse

Protein Ontology

More...
PROi
PR:Q811T9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000043051 Expressed in 34 organ(s), highest expression level in cerebral cortex
ExpressionAtlasiQ811T9 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR026081 DISC1
PANTHERiPTHR14332 PTHR14332, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDISC1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q811T9
Secondary accession number(s): Q7TQ21
, Q8CF87, Q8CF88, Q8CHP1, Q8CHP2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: June 13, 2006
Last modified: October 16, 2019
This is version 119 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again