Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 178 (16 Oct 2019)
Sequence version 1 (01 Jun 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Disks large homolog 1

Gene

Dlg1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Essential multidomain scaffolding protein required for normal development. Recruits channels, receptors and signaling molecules to discrete plasma membrane domains in polarized cells. Regulates the excitability of cardiac myocytes by modulating the functional expression of Kv4 channels (By similarity). Functional regulator of Kv1.5 channel (By similarity). May play a role in adherens junction assembly, signal transduction, cell proliferation, synaptogenesis and lymphocyte activation. During long-term depression in hippocampal neurons, it recruits ADAM10 to the plasma membrane (PubMed:23676497).By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-399719 Trafficking of AMPA receptors
R-MMU-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-MMU-451308 Activation of Ca-permeable Kainate Receptor
R-MMU-5673001 RAF/MAP kinase cascade
R-MMU-8849932 Synaptic adhesion-like molecules

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disks large homolog 1
Alternative name(s):
Embryo-dlg/synapse-associated protein 97
Short name:
E-dlg/SAP97
Synapse-associated protein 97
Short name:
SAP-97
Short name:
SAP97
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dlg1
Synonyms:Dlgh1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:107231 Dlg1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice have craniofacial abnormalities as well as a cleft palate. They are smaller than heterozygous littermates, unable to feed and die within 24 hours of birth.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000945491 – 905Disks large homolog 1Add BLAST905

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei122PhosphoserineBy similarity1
Modified residuei138PhosphoserineCombined sources1
Modified residuei158PhosphoserineBy similarity1
Modified residuei232PhosphoserineBy similarity1
Modified residuei399PhosphotyrosineCombined sources1
Modified residuei568PhosphoserineBy similarity1
Modified residuei573PhosphoserineCombined sources1
Modified residuei575PhosphoserineCombined sources1
Modified residuei579PhosphoserineBy similarity1
Modified residuei598PhosphoserineCombined sources1
Modified residuei619PhosphoserineCombined sources1
Modified residuei685PhosphoserineBy similarity1
Modified residuei688PhosphoserineBy similarity1
Modified residuei835PhosphoserineBy similarity1
Isoform 2 (identifier: Q811D0-2)
Modified residuei676PhosphoserineCombined sources1
Isoform 3 (identifier: Q811D0-3)
Modified residuei710PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by MAPK12. Phosphorylation of Ser-232 regulates association with GRIN2A (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q811D0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q811D0

PeptideAtlas

More...
PeptideAtlasi
Q811D0

PRoteomics IDEntifications database

More...
PRIDEi
Q811D0

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q811D0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q811D0

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q811D0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the brain (at protein level) (PubMed:23676497). Expressed in the outer limiting membrane and outer plexiform layer in the retina (at protein level) (PubMed:16519681). Expressed in epithelial, mesenchymal, neuronal, endothelial and hematopoietic cells during embryogenesis. Expressed in fibroblasts and T-cells. Widely expressed in adult mice.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000022770 Expressed in 291 organ(s), highest expression level in metanephric cortical collecting duct

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q811D0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q811D0 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer (Probable).

Interacts (via guanylate kinase-like domain) with DLGAP1, DLGAP2, DLGAP3, DLGAP4, and MAP1A (By similarity).

Interacts (via guanylate kinase-like domain) with KIF13B (By similarity). May interact with HTR2A (PubMed:14988405).

Interacts (via PDZ domains) with GRIA1 (By similarity).

Interacts (via PDZ domains) with GRIN2A (By similarity).

Interacts (via PDZ domains) with KCND2 and KCND3 (By similarity).

Interacts (via PDZ domains) with KCNA1, KCNA2, KCNA3, KCNA4, and ADGRA3 (By similarity).

Interacts with KCNF1 (By similarity).

Interacts with CAMK2 (By similarity).

Interacts with cytoskeleton-associated protein EPB41 (By similarity).

Interacts with cytoskeleton-associated protein EZR (PubMed:8922391).

Found in a complex with KCNA5 and CAV3 (PubMed:15277200).

Found in a complex with APC and CTNNB1 (PubMed:8638125).

Interacts with CDH1 through binding to PIK3R1 (By similarity). Forms multiprotein complexes with CASK, LIN7A, LIN7B, LIN7C, APBA1, and KCNJ12 (By similarity).

Interacts with TOPK (By similarity).

Forms a tripartite complex composed of DLG1, MPP7 and LIN7 (LIN7A or LIN7C) (By similarity). May interact with TJAP1 (By similarity).

Interacts with PTEN (By similarity).

Interacts with LRFN1, LRFN2, LRFN4 and SFPQ (By similarity).

Interacts with FRMPD4 (via C-terminus) (By similarity).

Interacts (via PDZ domains) with ADGRA2 (via PDZ-binding motif) (PubMed:25558062).

Interacts with ADAM10; this interaction recruits ADAM10 to the cell membrane during long-term depression in hippocampal neurons (PubMed:23676497).

By similarityCurated6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
199228, 21 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q811D0

Database of interacting proteins

More...
DIPi
DIP-31591N

Protein interaction database and analysis system

More...
IntActi
Q811D0, 23 interactors

Molecular INTeraction database

More...
MINTi
Q811D0

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000064280

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1905
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q811D0

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini4 – 64L27PROSITE-ProRule annotationAdd BLAST61
Domaini224 – 311PDZ 1PROSITE-ProRule annotationAdd BLAST88
Domaini319 – 406PDZ 2PROSITE-ProRule annotationAdd BLAST88
Domaini466 – 547PDZ 3PROSITE-ProRule annotationAdd BLAST82
Domaini581 – 651SH3PROSITE-ProRule annotationAdd BLAST71
Domaini715 – 890Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni162 – 212Interaction with SH3 domainsBy similarityAdd BLAST51

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PDZ domains may also mediate association to membranes by binding to EPB41 and ADGRA2 together with the L27 domain that binds CASK and DLG2.By similarity
The L27 domain may regulate DLG1 self-association. The N-terminal alternatively spliced region is capable of binding several SH3 domains and also moderates the level of protein oligomerization (By similarity).By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0708 Eukaryota
COG0194 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159409

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232102

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q811D0

KEGG Orthology (KO)

More...
KOi
K12076

Identification of Orthologs from Complete Genome Data

More...
OMAi
CIDHSQP

Database of Orthologous Groups

More...
OrthoDBi
807583at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q811D0

TreeFam database of animal gene trees

More...
TreeFami
TF323171

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016313 DLG1-like
IPR019590 DLG1_PEST_dom
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR015143 L27_1
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR019583 PDZ_assoc
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF09058 L27_1, 1 hit
PF10608 MAGUK_N_PEST, 1 hit
PF00595 PDZ, 3 hits
PF10600 PDZ_assoc, 1 hit
PF00018 SH3_1, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001741 MAGUK_DLGH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 1 hit
SM01277 MAGUK_N_PEST, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q811D0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVRKQDTQR ALHLLEEYRS KLSQTEDRQL RSSIERVINI FQSNLFQALI
60 70 80 90 100
DIQEFYEVTL LDNPKCVDHS KQCEPVQPVT TWEIASLPST AVTSETLPGS
110 120 130 140 150
LSPPVEKYRY QDEEVLPPEH ISPQVTNEVL GPELVHVSEK NLSEIENVHG
160 170 180 190 200
FVSHSHISPI KPTEAVPPSS PIVPVTPALP VPAESTVVLP SAPQANPPPV
210 220 230 240 250
LVNTDSLETP TYVNGTDADY EYEEITLERG NSGLGFSIAG GTDNPHIGDD
260 270 280 290 300
SSIFITKIIT GGAAAQDGRL RVNDCILRVN EADVRDVTHS KAVEALKEAG
310 320 330 340 350
SIVRLYVKRR KPASEKIMEI KLIKGPKGLG FSIAGGVGNQ HIPGDNSIYV
360 370 380 390 400
TKIIEGGAAH KDGKLQIGDK LLAVNSVCLE EVTHEEAVTA LKNTSDFVYL
410 420 430 440 450
KVAKPTSMYI NDGYAPPDIT NSSSQSVDNH VSPSSCLGQT PTSPARYSPI
460 470 480 490 500
SKAVLGDDEI TREPRKVVLH RGSTGLGFNI VGGEDGEGIF ISFILAGGPA
510 520 530 540 550
DLSGELRKGD RIISVNSVDL RAASHEQAAA ALKNAGQAVT IVAQYRPEEY
560 570 580 590 600
SRFEAKIHDL REQMMNSSVS SGSGSLRTSQ KRSLYVRALF DYDKTKDSGL
610 620 630 640 650
PSQGLNFRFG DILHVINASD DEWWQARQVT PDGESDEVGV IPSKRRVEKK
660 670 680 690 700
ERARLKTVKF NSKTRGDKGE IPDDMGSKGL KHVTSNASDS ESSYRGQEEY
710 720 730 740 750
VLSYEPVNQQ EVNYTRPVII LGPMKDRVND DLISEFPDKF GSCVPHTTRP
760 770 780 790 800
KRDYEVDGRD YHFVTSREQM EKDIQEHKFI EAGQYNNHLY GTSVQSVRAV
810 820 830 840 850
AEKGKHCILD VSGNAIKRLQ IAQLYPISIF IKPKSMENIM EMNKRLTEEQ
860 870 880 890 900
ARKTFERAMK LEQEFTEHFT AIVQGDTLED IYNQVKQIIE EQSGPYIWVP

AKEKL
Length:905
Mass (Da):100,120
Last modified:June 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i950A465824AE3210
GO
Isoform 2 (identifier: Q811D0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-194: Missing.
     670-681: EIPDDMGSKGLK → SFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ

Show »
Length:893
Mass (Da):99,630
Checksum:i085DFCCCC2067FEB
GO
Isoform 3 (identifier: Q811D0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-681: EIPDDMGSKGLK → QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ

Show »
Length:927
Mass (Da):102,986
Checksum:i885671B7DACA7CD3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z3B8D3Z3B8_MOUSE
Disks large homolog 1
Dlg1
834Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BWY4H7BWY4_MOUSE
Disks large homolog 1
Dlg1
872Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q9H0E9Q9H0_MOUSE
Disks large homolog 1
Dlg1
912Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R2T8S4R2T8_MOUSE
Disks large homolog 1
Dlg1
558Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6UDT8F6UDT8_MOUSE
Disks large homolog 1
Dlg1
358Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R2V5S4R2V5_MOUSE
Disks large homolog 1
Dlg1
30Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti263A → R in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti276I → V in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti312P → L in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti337V → I in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti470H → R in AAN87264 (Ref. 2) Curated1
Sequence conflicti482G → A in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti550 – 551YS → SR in AAC31653 (PubMed:9434093).Curated2
Sequence conflicti568S → R in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti576L → P in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti647V → A in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti700Y → C in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti754Y → I in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti769 – 770QM → RV in AAC31653 (PubMed:9434093).Curated2
Sequence conflicti900P → L in AAC31653 (PubMed:9434093).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_012866162 – 194Missing in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_012867670 – 681EIPDD…SKGLK → SFNDKRKKNLFSRKFPFYKN KDQSEQETSDADQ in isoform 2. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_012868670 – 681EIPDD…SKGLK → QSFNDKRKKNLFSRKFPFYK NKDQSEQETSDADQ in isoform 3. 2 PublicationsAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U93309 mRNA Translation: AAC31653.1
AY159380 mRNA Translation: AAN87264.1
BC047142 mRNA Translation: AAH47142.1
BC057118 mRNA Translation: AAH57118.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS28107.1 [Q811D0-3]
CCDS57025.1 [Q811D0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001239362.1, NM_001252433.1 [Q811D0-2]
NP_001239363.1, NM_001252434.1
NP_001239364.1, NM_001252435.1 [Q811D0-1]
NP_031888.2, NM_007862.3 [Q811D0-3]
XP_006521831.1, XM_006521768.3 [Q811D0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000064477; ENSMUSP00000064280; ENSMUSG00000022770 [Q811D0-3]
ENSMUST00000100001; ENSMUSP00000097581; ENSMUSG00000022770 [Q811D0-1]
ENSMUST00000115205; ENSMUSP00000110859; ENSMUSG00000022770 [Q811D0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
13383

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:13383

UCSC genome browser

More...
UCSCi
uc007yxo.2 mouse [Q811D0-1]
uc007yxp.2 mouse [Q811D0-3]
uc007yxs.2 mouse [Q811D0-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U93309 mRNA Translation: AAC31653.1
AY159380 mRNA Translation: AAN87264.1
BC047142 mRNA Translation: AAH47142.1
BC057118 mRNA Translation: AAH57118.1
CCDSiCCDS28107.1 [Q811D0-3]
CCDS57025.1 [Q811D0-1]
RefSeqiNP_001239362.1, NM_001252433.1 [Q811D0-2]
NP_001239363.1, NM_001252434.1
NP_001239364.1, NM_001252435.1 [Q811D0-1]
NP_031888.2, NM_007862.3 [Q811D0-3]
XP_006521831.1, XM_006521768.3 [Q811D0-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4OAJX-ray2.30A317-406[»]
SMRiQ811D0
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi199228, 21 interactors
CORUMiQ811D0
DIPiDIP-31591N
IntActiQ811D0, 23 interactors
MINTiQ811D0
STRINGi10090.ENSMUSP00000064280

PTM databases

iPTMnetiQ811D0
PhosphoSitePlusiQ811D0
SwissPalmiQ811D0

Proteomic databases

jPOSTiQ811D0
PaxDbiQ811D0
PeptideAtlasiQ811D0
PRIDEiQ811D0

Genome annotation databases

EnsembliENSMUST00000064477; ENSMUSP00000064280; ENSMUSG00000022770 [Q811D0-3]
ENSMUST00000100001; ENSMUSP00000097581; ENSMUSG00000022770 [Q811D0-1]
ENSMUST00000115205; ENSMUSP00000110859; ENSMUSG00000022770 [Q811D0-1]
GeneIDi13383
KEGGimmu:13383
UCSCiuc007yxo.2 mouse [Q811D0-1]
uc007yxp.2 mouse [Q811D0-3]
uc007yxs.2 mouse [Q811D0-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1739
MGIiMGI:107231 Dlg1

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00940000159409
HOGENOMiHOG000232102
InParanoidiQ811D0
KOiK12076
OMAiCIDHSQP
OrthoDBi807583at2759
PhylomeDBiQ811D0
TreeFamiTF323171

Enzyme and pathway databases

ReactomeiR-MMU-399719 Trafficking of AMPA receptors
R-MMU-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-MMU-451308 Activation of Ca-permeable Kainate Receptor
R-MMU-5673001 RAF/MAP kinase cascade
R-MMU-8849932 Synaptic adhesion-like molecules

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Dlg1 mouse

Protein Ontology

More...
PROi
PR:Q811D0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000022770 Expressed in 291 organ(s), highest expression level in metanephric cortical collecting duct
ExpressionAtlasiQ811D0 baseline and differential
GenevisibleiQ811D0 MM

Family and domain databases

InterProiView protein in InterPro
IPR016313 DLG1-like
IPR019590 DLG1_PEST_dom
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR015143 L27_1
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR019583 PDZ_assoc
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF09058 L27_1, 1 hit
PF10608 MAGUK_N_PEST, 1 hit
PF00595 PDZ, 3 hits
PF10600 PDZ_assoc, 1 hit
PF00018 SH3_1, 1 hit
PIRSFiPIRSF001741 MAGUK_DLGH, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 1 hit
SM01277 MAGUK_N_PEST, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDLG1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q811D0
Secondary accession number(s): Q62402, Q6PGB5, Q8CGN7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: June 1, 2003
Last modified: October 16, 2019
This is version 178 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again