Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SLIT and NTRK-like protein 5

Gene

Slitrk5

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Suppresses neurite outgrowth.1 Publication

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-MMU-388844 Receptor-type tyrosine-protein phosphatases

Names & Taxonomyi

Protein namesi
Recommended name:
SLIT and NTRK-like protein 5
Gene namesi
Name:Slitrk5
OrganismiMus musculus (Mouse)Imported
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:2679448 Slitrk5

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini41 – 664ExtracellularSequence analysisAdd BLAST624
Transmembranei665 – 685HelicalSequence analysisAdd BLAST21
Topological domaini686 – 957CytoplasmicSequence analysisAdd BLAST272

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 40Sequence analysisAdd BLAST40
ChainiPRO_000003268241 – 957SLIT and NTRK-like protein 5Sequence analysisAdd BLAST917

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi103N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi644N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ810B7
PRIDEiQ810B7

PTM databases

iPTMnetiQ810B7
PhosphoSitePlusiQ810B7

Expressioni

Tissue specificityi

In the adult, significant expression is detected only in the brain. In the embryo, expressed in the subventricular zone, cortical plate, pyramidal layer of hippocampus, thalamus and hypothalamus.1 Publication

Gene expression databases

BgeeiENSMUSG00000033214 Expressed in 117 organ(s), highest expression level in CA1 field of hippocampus
CleanExiMM_SLITRK5
GenevisibleiQ810B7 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000041499

Structurei

3D structure databases

ProteinModelPortaliQ810B7
SMRiQ810B7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati82 – 103LRR 1Add BLAST22
Repeati106 – 127LRR 2Add BLAST22
Repeati130 – 151LRR 3Add BLAST22
Repeati154 – 175LRR 4Add BLAST22
Repeati178 – 199LRR 5Add BLAST22
Repeati201 – 222LRR 6Add BLAST22
Domaini235 – 286LRRCT 1Add BLAST52
Domaini365 – 407LRRNTAdd BLAST43
Repeati410 – 431LRR 7Add BLAST22
Repeati434 – 455LRR 8Add BLAST22
Repeati458 – 479LRR 9Add BLAST22
Repeati482 – 503LRR 10Add BLAST22
Repeati506 – 527LRR 11Add BLAST22
Repeati529 – 550LRR 12Add BLAST22
Domaini563 – 614LRRCT 2Add BLAST52

Sequence similaritiesi

Belongs to the SLITRK family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IGN5 Eukaryota
ENOG4111D19 LUCA
GeneTreeiENSGT00910000144028
HOGENOMiHOG000290667
HOVERGENiHBG056407
InParanoidiQ810B7
OMAiCENRGII
OrthoDBiEOG091G02AI
PhylomeDBiQ810B7
TreeFamiTF326378

Family and domain databases

Gene3Di3.80.10.10, 2 hits
InterProiView protein in InterPro
IPR000483 Cys-rich_flank_reg_C
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
PfamiView protein in Pfam
PF13855 LRR_8, 2 hits
SMARTiView protein in SMART
SM00369 LRR_TYP, 10 hits
SM00082 LRRCT, 2 hits
PROSITEiView protein in PROSITE
PS51450 LRR, 11 hits

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q810B7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHVCCPPVTL EQDLHRKMHS WMLQTLAFAV TSLVLSCAET IDYYGEICDN
60 70 80 90 100
ACPCEEKDGI LTVSCENRGI ISLSEISPPR FPIYHLLLSG NLLSRLYPNE
110 120 130 140 150
FVNYTGASIL HLGSNVIQDI ETGAFHGLRG LRRLHLNNNK LELLRDDTFL
160 170 180 190 200
GLENLEYLQV DYNYISVIEP NAFGKLHMLQ VLILNDNLLS GLPNNLFRFV
210 220 230 240 250
PLTHLDLRGN RLKLLPYVGL LQHMDKVVEL QLEENPWNCS CELISLKDWL
260 270 280 290 300
DSISYSALVG DVVCETPFRL HGRDLDEVSK QELCPRKLIS DYEMRPQTPL
310 320 330 340 350
STTGYLHTTP ASVNSVATSS SAVYKPPLKP PKGTRQPNKP RVRPTSRQPS
360 370 380 390 400
KDLGYSNYGP SIAYQTKSPV PLECPTACTC NLQISDLGLN VNCQERKIES
410 420 430 440 450
IAELQPKPYN PKKMYLTENY ITVVRRTDFL EATGLDLLHL GNNRISMIQD
460 470 480 490 500
RAFGDLGNLR RLYLNGNRIE RLSPELFYGL QSLQYLFLQY NLIREIQAGT
510 520 530 540 550
FDPVPNLQLL FLNNNQLQAM PSGVFSGLTL LRLNLRGNSF TSLPVSGVLD
560 570 580 590 600
QLTSLIQIDL HDNPWDCTCD VVGMKLWIEQ LKVGVLVDEV ICKAPKKFAE
610 620 630 640 650
TYMRSIKSEL LCPDYSDVVV STPTPSSIQV PSRTNAATPA VRLNSTGTPA
660 670 680 690 700
GLGAGTGASS VPLSVLILSL LLVFIMSVFV AAGLFVLVMK RRKKNQSDHT
710 720 730 740 750
STNNSDVSSF NMQYSVYGGG GGGGGGHPHA HVHHRGPALP KVKTPAGHVY
760 770 780 790 800
EYIPHPLGHM CKNPIYRSRE GNSVEDYKDL HELKVTYSSN HHLQQQPPPP
810 820 830 840 850
PQQPQQQPPP QMQMQPGEEE RRESHHLRSP AYSVSTIEPR EDLLSPVQDA
860 870 880 890 900
DRFYRGILEP DKHCSTTPAG SSLPEYPKFP CSPAAYTFSP NYDLRRPHQY
910 920 930 940 950
LHPGAGESRL REPVLYSPPG AVFVEPNRNE YLELKAKLNV EPDYLEVLEK

QTTFSQF
Length:957
Mass (Da):107,165
Last modified:June 1, 2003 - v1
Checksum:i0CB89BD7FE2D18AF
GO
Isoform 2Curated (identifier: Q810B7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     706-722: DVSSFNMQYSVYGGGGG → AATAPAAAPSADADAAW
     726-755: GHPHAHVHHRGPALPKVKTPAGHVYEYIPH → EAGKPPFEEPRLQRQHHRAPRGPTVAGAGR
     756-957: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:755
Mass (Da):83,704
Checksum:iA26B07F14E900127
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2I3BQY9A0A2I3BQY9_MOUSE
SLIT and NTRK-like protein 5
Slitrk5
132Annotation score:

Sequence cautioni

The sequence AK011457 differs from that shown. Reason: Frameshift at position 836.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti153E → D in AAH65107 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_050708706 – 722DVSSF…GGGGG → AATAPAAAPSADADAAW in isoform 2. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_050709726 – 755GHPHA…EYIPH → EAGKPPFEEPRLQRQHHRAP RGPTVAGAGR in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_050710756 – 957Missing in isoform 2. 1 PublicationAdd BLAST202

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB097574 Genomic DNA Translation: BAC67208.1
BC065107 mRNA Translation: AAH65107.1
AK011457 mRNA No translation available.
CCDSiCCDS27328.1 [Q810B7-1]
RefSeqiNP_942565.1, NM_198865.1 [Q810B7-1]
XP_006519705.1, XM_006519642.3 [Q810B7-1]
XP_006519706.1, XM_006519643.3 [Q810B7-1]
UniGeneiMm.235097
Mm.417152

Genome annotation databases

EnsembliENSMUST00000042767; ENSMUSP00000041499; ENSMUSG00000033214 [Q810B7-1]
GeneIDi75409
KEGGimmu:75409
UCSCiuc011zpr.1 mouse [Q810B7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB097574 Genomic DNA Translation: BAC67208.1
BC065107 mRNA Translation: AAH65107.1
AK011457 mRNA No translation available.
CCDSiCCDS27328.1 [Q810B7-1]
RefSeqiNP_942565.1, NM_198865.1 [Q810B7-1]
XP_006519705.1, XM_006519642.3 [Q810B7-1]
XP_006519706.1, XM_006519643.3 [Q810B7-1]
UniGeneiMm.235097
Mm.417152

3D structure databases

ProteinModelPortaliQ810B7
SMRiQ810B7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000041499

PTM databases

iPTMnetiQ810B7
PhosphoSitePlusiQ810B7

Proteomic databases

PaxDbiQ810B7
PRIDEiQ810B7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000042767; ENSMUSP00000041499; ENSMUSG00000033214 [Q810B7-1]
GeneIDi75409
KEGGimmu:75409
UCSCiuc011zpr.1 mouse [Q810B7-1]

Organism-specific databases

CTDi26050
MGIiMGI:2679448 Slitrk5

Phylogenomic databases

eggNOGiENOG410IGN5 Eukaryota
ENOG4111D19 LUCA
GeneTreeiENSGT00910000144028
HOGENOMiHOG000290667
HOVERGENiHBG056407
InParanoidiQ810B7
OMAiCENRGII
OrthoDBiEOG091G02AI
PhylomeDBiQ810B7
TreeFamiTF326378

Enzyme and pathway databases

ReactomeiR-MMU-388844 Receptor-type tyrosine-protein phosphatases

Miscellaneous databases

ChiTaRSiSlitrk5 mouse
PROiPR:Q810B7
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000033214 Expressed in 117 organ(s), highest expression level in CA1 field of hippocampus
CleanExiMM_SLITRK5
GenevisibleiQ810B7 MM

Family and domain databases

Gene3Di3.80.10.10, 2 hits
InterProiView protein in InterPro
IPR000483 Cys-rich_flank_reg_C
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
PfamiView protein in Pfam
PF13855 LRR_8, 2 hits
SMARTiView protein in SMART
SM00369 LRR_TYP, 10 hits
SM00082 LRRCT, 2 hits
PROSITEiView protein in PROSITE
PS51450 LRR, 11 hits
ProtoNetiSearch...

Entry informationi

Entry nameiSLIK5_MOUSE
AccessioniPrimary (citable) accession number: Q810B7
Secondary accession number(s): Q9CT21
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: June 1, 2003
Last modified: September 12, 2018
This is version 129 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again