Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 109 (12 Aug 2020)
Sequence version 2 (15 Mar 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

F-box only protein 34

Gene

Fbxo34

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.By similarity

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processUbl conjugation pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
F-box only protein 34
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Fbxo34
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1926188, Fbxo34

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001199271 – 695F-box only protein 34Add BLAST695

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q80XI1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q80XI1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q80XI1

PRoteomics IDEntifications database

More...
PRIDEi
Q80XI1

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q80XI1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q80XI1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000037536, Expressed in dorsal pancreas and 240 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q80XI1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q80XI1, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Directly interacts with SKP1 and CUL1.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
219722, 4 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000044675

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q80XI1, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini556 – 608F-boxPROSITE-ProRule annotationAdd BLAST53

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QRQQ, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000064222

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_418530_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q80XI1

KEGG Orthology (KO)

More...
KOi
K10311

Identification of Orthologs from Complete Genome Data

More...
OMAi
NSNRYDV

Database of Orthologous Groups

More...
OrthoDBi
329015at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q80XI1

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036047, F-box-like_dom_sf
IPR001810, F-box_dom
IPR039594, FBXO34/46

The PANTHER Classification System

More...
PANTHERi
PTHR16271, PTHR16271, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00646, F-box, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00256, FBOX, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF81383, SSF81383, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50181, FBOX, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q80XI1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHLKLYWKLQ KKERPLEVSR DTLRTPMSHG KANGDVKARA SYMKPTVLPS
60 70 80 90 100
ASLVKASSRK PFGILSPNVL CSMSGKSPVE NSLNVKAKKN VLSAAVHQSE
110 120 130 140 150
EGLPGTWAIV KPGNTKEKIA FFAAHQYSNR IGSMKIKSSW DIDGRATKRR
160 170 180 190 200
KKSGDLKKAK LQLEMMREIN SQCYQSEPFV CGVEHCSVHY MSDSGDGVCA
210 220 230 240 250
ARPLSVIQMV AFLEQKATAL LASCTKNCTN SPAIVKISGQ SRGIPPAPEP
260 270 280 290 300
FSAPETCEEP KEQENPETGR SQGEPVRVLD MVARLESECL KHQGQREPGS
310 320 330 340 350
LSRNNSFRRN VGRVLLTNGS QASDKSEEGS ADTADPQENP LQPVSVGEEP
360 370 380 390 400
SVTEHHSVGE QAWDGTSQSC PSLPATVSFH MDSTDLEPGQ QTAMKSCSRD
410 420 430 440 450
DVEMVEEFDE LPTDAVRRIR RELVTVTKHS PEQRQDPLCI SITVCTVEKD
460 470 480 490 500
RPAALDSLEE PLPGMLFFLS SGQDQQAHPQ LREHPAPEAS EASQPQDAAE
510 520 530 540 550
GSSAGEEKDA SVEPLLPAAS PGGSTSQVLE AATCKKQVSQ DFLETRFKIQ
560 570 580 590 600
QLLEPQQYMA CLPHHIIVKI FRLLPTLSLA ILKCTCRYFK SIIEYYNIRP
610 620 630 640 650
ADSRWVRDPR YREDPCKQCK KKYVKGDVSL CRWHPKPYCQ ALPYGPGYWM
660 670 680 690
CCHQSQKGFP GCKLGLHDNH WLPACHSFNR AIHKKTRGSE TEEEY
Length:695
Mass (Da):77,138
Last modified:March 15, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD97EFBB6588E5FCC
GO
Isoform 2 (identifier: Q80XI1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGFGASVGLRRSALSSWSASVSGSESGLPPPHRAAAAPGQALARQKHRASV

Show »
Length:745
Mass (Da):82,102
Checksum:iA232A91D83ACA844
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QM55E9QM55_MOUSE
F-box only protein 34
Fbxo34
746Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BS05A0A2I3BS05_MOUSE
F-box only protein 34
Fbxo34
44Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BPD7A0A2I3BPD7_MOUSE
F-box only protein 34
Fbxo34
45Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BR79A0A2I3BR79_MOUSE
F-box only protein 34
Fbxo34
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BQA4A0A2I3BQA4_MOUSE
F-box only protein 34
Fbxo34
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BQU0A0A2I3BQU0_MOUSE
F-box only protein 34
Fbxo34
88Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BRP7A0A2I3BRP7_MOUSE
F-box only protein 34
Fbxo34
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BRE0A0A2I3BRE0_MOUSE
F-box only protein 34
Fbxo34
28Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti165M → I in AAH48149 (PubMed:15489334).Curated1
Sequence conflicti236K → E in BAB31968 (PubMed:16141072).Curated1
Sequence conflicti491E → K in BAB31968 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0130551M → MGFGASVGLRRSALSSWSAS VSGSESGLPPPHRAAAAPGQ ALARQKHRASV in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK020018 mRNA Translation: BAB31968.1
BC048149 mRNA Translation: AAH48149.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS49471.1 [Q80XI1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001139557.1, NM_001146085.1 [Q80XI1-1]
NP_001139558.1, NM_001146086.1 [Q80XI1-1]
NP_084512.2, NM_030236.3
XP_006519776.1, XM_006519713.1 [Q80XI1-1]
XP_006519777.1, XM_006519714.1 [Q80XI1-1]
XP_006519780.1, XM_006519717.2 [Q80XI1-1]
XP_006519781.1, XM_006519718.3 [Q80XI1-1]
XP_006519782.1, XM_006519719.1 [Q80XI1-1]
XP_006519783.1, XM_006519720.1 [Q80XI1-1]
XP_006519785.1, XM_006519722.1 [Q80XI1-1]
XP_006519786.1, XM_006519723.3
XP_017171714.1, XM_017316225.1 [Q80XI1-1]
XP_017171715.1, XM_017316226.1 [Q80XI1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000095941; ENSMUSP00000093634; ENSMUSG00000037536 [Q80XI1-1]
ENSMUST00000163324; ENSMUSP00000131708; ENSMUSG00000037536 [Q80XI1-1]
ENSMUST00000165714; ENSMUSP00000130036; ENSMUSG00000037536 [Q80XI1-1]
ENSMUST00000168833; ENSMUSP00000132271; ENSMUSG00000037536 [Q80XI1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
78938

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:78938

UCSC genome browser

More...
UCSCi
uc007tih.2, mouse [Q80XI1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK020018 mRNA Translation: BAB31968.1
BC048149 mRNA Translation: AAH48149.1
CCDSiCCDS49471.1 [Q80XI1-1]
RefSeqiNP_001139557.1, NM_001146085.1 [Q80XI1-1]
NP_001139558.1, NM_001146086.1 [Q80XI1-1]
NP_084512.2, NM_030236.3
XP_006519776.1, XM_006519713.1 [Q80XI1-1]
XP_006519777.1, XM_006519714.1 [Q80XI1-1]
XP_006519780.1, XM_006519717.2 [Q80XI1-1]
XP_006519781.1, XM_006519718.3 [Q80XI1-1]
XP_006519782.1, XM_006519719.1 [Q80XI1-1]
XP_006519783.1, XM_006519720.1 [Q80XI1-1]
XP_006519785.1, XM_006519722.1 [Q80XI1-1]
XP_006519786.1, XM_006519723.3
XP_017171714.1, XM_017316225.1 [Q80XI1-1]
XP_017171715.1, XM_017316226.1 [Q80XI1-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi219722, 4 interactors
STRINGi10090.ENSMUSP00000044675

PTM databases

iPTMnetiQ80XI1
PhosphoSitePlusiQ80XI1

Proteomic databases

EPDiQ80XI1
jPOSTiQ80XI1
PaxDbiQ80XI1
PRIDEiQ80XI1

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
24028, 105 antibodies

Genome annotation databases

EnsembliENSMUST00000095941; ENSMUSP00000093634; ENSMUSG00000037536 [Q80XI1-1]
ENSMUST00000163324; ENSMUSP00000131708; ENSMUSG00000037536 [Q80XI1-1]
ENSMUST00000165714; ENSMUSP00000130036; ENSMUSG00000037536 [Q80XI1-1]
ENSMUST00000168833; ENSMUSP00000132271; ENSMUSG00000037536 [Q80XI1-1]
GeneIDi78938
KEGGimmu:78938
UCSCiuc007tih.2, mouse [Q80XI1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55030
MGIiMGI:1926188, Fbxo34

Phylogenomic databases

eggNOGiENOG502QRQQ, Eukaryota
GeneTreeiENSGT00530000064222
HOGENOMiCLU_418530_0_0_1
InParanoidiQ80XI1
KOiK10311
OMAiNSNRYDV
OrthoDBi329015at2759
PhylomeDBiQ80XI1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
78938, 1 hit in 19 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Fbxo34, mouse

Protein Ontology

More...
PROi
PR:Q80XI1
RNActiQ80XI1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000037536, Expressed in dorsal pancreas and 240 other tissues
ExpressionAtlasiQ80XI1, baseline and differential
GenevisibleiQ80XI1, MM

Family and domain databases

InterProiView protein in InterPro
IPR036047, F-box-like_dom_sf
IPR001810, F-box_dom
IPR039594, FBXO34/46
PANTHERiPTHR16271, PTHR16271, 1 hit
PfamiView protein in Pfam
PF00646, F-box, 1 hit
SMARTiView protein in SMART
SM00256, FBOX, 1 hit
SUPFAMiSSF81383, SSF81383, 1 hit
PROSITEiView protein in PROSITE
PS50181, FBOX, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFBX34_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q80XI1
Secondary accession number(s): Q9D290
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: March 15, 2005
Last modified: August 12, 2020
This is version 109 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again