Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-box only protein 34

Gene

Fbxo34

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.By similarity

Keywordsi

Biological processUbl conjugation pathway

Names & Taxonomyi

Protein namesi
Recommended name:
F-box only protein 34
Gene namesi
Name:Fbxo34
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:1926188 Fbxo34

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001199271 – 695F-box only protein 34Add BLAST695

Proteomic databases

EPDiQ80XI1
PaxDbiQ80XI1
PRIDEiQ80XI1

PTM databases

iPTMnetiQ80XI1
PhosphoSitePlusiQ80XI1

Expressioni

Gene expression databases

BgeeiENSMUSG00000037536 Expressed in 223 organ(s), highest expression level in dorsal pancreas
CleanExiMM_FBXO34
ExpressionAtlasiQ80XI1 baseline and differential
GenevisibleiQ80XI1 MM

Interactioni

Subunit structurei

Directly interacts with SKP1 and CUL1.By similarity

Protein-protein interaction databases

BioGridi219722, 2 interactors
STRINGi10090.ENSMUSP00000044675

Structurei

3D structure databases

ProteinModelPortaliQ80XI1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini556 – 608F-boxPROSITE-ProRule annotationAdd BLAST53

Phylogenomic databases

eggNOGiENOG410IJQD Eukaryota
ENOG410ZZJ3 LUCA
GeneTreeiENSGT00530000064222
HOGENOMiHOG000237319
HOVERGENiHBG051576
InParanoidiQ80XI1
KOiK10311
PhylomeDBiQ80XI1

Family and domain databases

InterProiView protein in InterPro
IPR036047 F-box-like_dom_sf
IPR001810 F-box_dom
PfamiView protein in Pfam
PF00646 F-box, 1 hit
SMARTiView protein in SMART
SM00256 FBOX, 1 hit
SUPFAMiSSF81383 SSF81383, 1 hit
PROSITEiView protein in PROSITE
PS50181 FBOX, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q80XI1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHLKLYWKLQ KKERPLEVSR DTLRTPMSHG KANGDVKARA SYMKPTVLPS
60 70 80 90 100
ASLVKASSRK PFGILSPNVL CSMSGKSPVE NSLNVKAKKN VLSAAVHQSE
110 120 130 140 150
EGLPGTWAIV KPGNTKEKIA FFAAHQYSNR IGSMKIKSSW DIDGRATKRR
160 170 180 190 200
KKSGDLKKAK LQLEMMREIN SQCYQSEPFV CGVEHCSVHY MSDSGDGVCA
210 220 230 240 250
ARPLSVIQMV AFLEQKATAL LASCTKNCTN SPAIVKISGQ SRGIPPAPEP
260 270 280 290 300
FSAPETCEEP KEQENPETGR SQGEPVRVLD MVARLESECL KHQGQREPGS
310 320 330 340 350
LSRNNSFRRN VGRVLLTNGS QASDKSEEGS ADTADPQENP LQPVSVGEEP
360 370 380 390 400
SVTEHHSVGE QAWDGTSQSC PSLPATVSFH MDSTDLEPGQ QTAMKSCSRD
410 420 430 440 450
DVEMVEEFDE LPTDAVRRIR RELVTVTKHS PEQRQDPLCI SITVCTVEKD
460 470 480 490 500
RPAALDSLEE PLPGMLFFLS SGQDQQAHPQ LREHPAPEAS EASQPQDAAE
510 520 530 540 550
GSSAGEEKDA SVEPLLPAAS PGGSTSQVLE AATCKKQVSQ DFLETRFKIQ
560 570 580 590 600
QLLEPQQYMA CLPHHIIVKI FRLLPTLSLA ILKCTCRYFK SIIEYYNIRP
610 620 630 640 650
ADSRWVRDPR YREDPCKQCK KKYVKGDVSL CRWHPKPYCQ ALPYGPGYWM
660 670 680 690
CCHQSQKGFP GCKLGLHDNH WLPACHSFNR AIHKKTRGSE TEEEY
Length:695
Mass (Da):77,138
Last modified:March 15, 2005 - v2
Checksum:iD97EFBB6588E5FCC
GO
Isoform 2 (identifier: Q80XI1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGFGASVGLRRSALSSWSASVSGSESGLPPPHRAAAAPGQALARQKHRASV

Note: No experimental confirmation available.
Show »
Length:745
Mass (Da):82,102
Checksum:iA232A91D83ACA844
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QM55E9QM55_MOUSE
F-box only protein 34
Fbxo34
746Annotation score:
A0A2I3BQA4A0A2I3BQA4_MOUSE
F-box only protein 34
Fbxo34
108Annotation score:
A0A2I3BR79A0A2I3BR79_MOUSE
F-box only protein 34
Fbxo34
51Annotation score:
A0A2I3BS05A0A2I3BS05_MOUSE
F-box only protein 34
Fbxo34
44Annotation score:
A0A2I3BPD7A0A2I3BPD7_MOUSE
F-box only protein 34
Fbxo34
45Annotation score:
A0A2I3BRP7A0A2I3BRP7_MOUSE
F-box only protein 34
Fbxo34
93Annotation score:
A0A2I3BRE0A0A2I3BRE0_MOUSE
F-box only protein 34
Fbxo34
28Annotation score:
A0A2I3BQU0A0A2I3BQU0_MOUSE
F-box only protein 34
Fbxo34
88Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti165M → I in AAH48149 (PubMed:15489334).Curated1
Sequence conflicti236K → E in BAB31968 (PubMed:16141072).Curated1
Sequence conflicti491E → K in BAB31968 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0130551M → MGFGASVGLRRSALSSWSAS VSGSESGLPPPHRAAAAPGQ ALARQKHRASV in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK020018 mRNA Translation: BAB31968.1
BC048149 mRNA Translation: AAH48149.1
CCDSiCCDS49471.1 [Q80XI1-1]
RefSeqiNP_001139557.1, NM_001146085.1 [Q80XI1-1]
NP_001139558.1, NM_001146086.1 [Q80XI1-1]
NP_084512.2, NM_030236.3
XP_006519776.1, XM_006519713.1 [Q80XI1-1]
XP_006519777.1, XM_006519714.1 [Q80XI1-1]
XP_006519780.1, XM_006519717.2 [Q80XI1-1]
XP_006519781.1, XM_006519718.3 [Q80XI1-1]
XP_006519782.1, XM_006519719.1 [Q80XI1-1]
XP_006519783.1, XM_006519720.1 [Q80XI1-1]
XP_006519785.1, XM_006519722.1 [Q80XI1-1]
XP_006519786.1, XM_006519723.3 [Q80XI1-1]
XP_017171714.1, XM_017316225.1 [Q80XI1-1]
XP_017171715.1, XM_017316226.1 [Q80XI1-1]
UniGeneiMm.11935

Genome annotation databases

EnsembliENSMUST00000095941; ENSMUSP00000093634; ENSMUSG00000037536 [Q80XI1-1]
ENSMUST00000163324; ENSMUSP00000131708; ENSMUSG00000037536 [Q80XI1-1]
ENSMUST00000165714; ENSMUSP00000130036; ENSMUSG00000037536 [Q80XI1-1]
ENSMUST00000168833; ENSMUSP00000132271; ENSMUSG00000037536 [Q80XI1-1]
GeneIDi78938
KEGGimmu:78938
UCSCiuc007tih.2 mouse [Q80XI1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK020018 mRNA Translation: BAB31968.1
BC048149 mRNA Translation: AAH48149.1
CCDSiCCDS49471.1 [Q80XI1-1]
RefSeqiNP_001139557.1, NM_001146085.1 [Q80XI1-1]
NP_001139558.1, NM_001146086.1 [Q80XI1-1]
NP_084512.2, NM_030236.3
XP_006519776.1, XM_006519713.1 [Q80XI1-1]
XP_006519777.1, XM_006519714.1 [Q80XI1-1]
XP_006519780.1, XM_006519717.2 [Q80XI1-1]
XP_006519781.1, XM_006519718.3 [Q80XI1-1]
XP_006519782.1, XM_006519719.1 [Q80XI1-1]
XP_006519783.1, XM_006519720.1 [Q80XI1-1]
XP_006519785.1, XM_006519722.1 [Q80XI1-1]
XP_006519786.1, XM_006519723.3 [Q80XI1-1]
XP_017171714.1, XM_017316225.1 [Q80XI1-1]
XP_017171715.1, XM_017316226.1 [Q80XI1-1]
UniGeneiMm.11935

3D structure databases

ProteinModelPortaliQ80XI1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi219722, 2 interactors
STRINGi10090.ENSMUSP00000044675

PTM databases

iPTMnetiQ80XI1
PhosphoSitePlusiQ80XI1

Proteomic databases

EPDiQ80XI1
PaxDbiQ80XI1
PRIDEiQ80XI1

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000095941; ENSMUSP00000093634; ENSMUSG00000037536 [Q80XI1-1]
ENSMUST00000163324; ENSMUSP00000131708; ENSMUSG00000037536 [Q80XI1-1]
ENSMUST00000165714; ENSMUSP00000130036; ENSMUSG00000037536 [Q80XI1-1]
ENSMUST00000168833; ENSMUSP00000132271; ENSMUSG00000037536 [Q80XI1-1]
GeneIDi78938
KEGGimmu:78938
UCSCiuc007tih.2 mouse [Q80XI1-1]

Organism-specific databases

CTDi55030
MGIiMGI:1926188 Fbxo34

Phylogenomic databases

eggNOGiENOG410IJQD Eukaryota
ENOG410ZZJ3 LUCA
GeneTreeiENSGT00530000064222
HOGENOMiHOG000237319
HOVERGENiHBG051576
InParanoidiQ80XI1
KOiK10311
PhylomeDBiQ80XI1

Miscellaneous databases

ChiTaRSiFbxo34 mouse
PROiPR:Q80XI1
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000037536 Expressed in 223 organ(s), highest expression level in dorsal pancreas
CleanExiMM_FBXO34
ExpressionAtlasiQ80XI1 baseline and differential
GenevisibleiQ80XI1 MM

Family and domain databases

InterProiView protein in InterPro
IPR036047 F-box-like_dom_sf
IPR001810 F-box_dom
PfamiView protein in Pfam
PF00646 F-box, 1 hit
SMARTiView protein in SMART
SM00256 FBOX, 1 hit
SUPFAMiSSF81383 SSF81383, 1 hit
PROSITEiView protein in PROSITE
PS50181 FBOX, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFBX34_MOUSE
AccessioniPrimary (citable) accession number: Q80XI1
Secondary accession number(s): Q9D290
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: March 15, 2005
Last modified: September 12, 2018
This is version 98 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again