Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin-associated protein 2-like

Gene

Ubap2l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays an important role in the activity of long-term repopulating hematopoietic stem cells (LT-HSCs) (PubMed:25185265).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • binding of sperm to zona pellucida Source: Ensembl
  • hematopoietic stem cell homeostasis Source: MGI

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ubiquitin-associated protein 2-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ubap2l
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1921633 Ubap2l

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002406651 – 1107Ubiquitin-associated protein 2-likeAdd BLAST1107

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
Modified residuei187Asymmetric dimethylarginineBy similarity1
Modified residuei190Asymmetric dimethylarginineBy similarity1
Modified residuei376PhosphoserineBy similarity1
Modified residuei380PhosphoserineBy similarity1
Modified residuei436PhosphoserineCombined sources1
Modified residuei445PhosphothreonineBy similarity1
Modified residuei474PhosphoserineBy similarity1
Modified residuei487PhosphoserineCombined sources1
Modified residuei490PhosphoserineBy similarity1
Modified residuei491PhosphoserineBy similarity1
Modified residuei497PhosphoserineCombined sources1
Modified residuei624PhosphoserineBy similarity1
Modified residuei625PhosphoserineCombined sources1
Modified residuei628PhosphoserineBy similarity1
Modified residuei629PhosphoserineCombined sources1
Modified residuei872PhosphoserineBy similarity1
Modified residuei879PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q80X50

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q80X50

PeptideAtlas

More...
PeptideAtlasi
Q80X50

PRoteomics IDEntifications database

More...
PRIDEi
Q80X50

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q80X50

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q80X50

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000042520 Expressed in 294 organ(s), highest expression level in embryonic stem cell

CleanEx database of gene expression profiles

More...
CleanExi
MM_UBAP2L

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q80X50 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q80X50 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with BMI1. Part of a complex consisting of UBAP2L, BMI1 and RNF2.By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
216707, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q80X50, 4 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000066138

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11107
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q80X50

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q80X50

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q80X50

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini49 – 89UBAPROSITE-ProRule annotationAdd BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi124 – 190Arg/Gly-richAdd BLAST67
Compositional biasi469 – 472Poly-Pro4
Compositional biasi473 – 799Ser/Thr-richAdd BLAST327

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGWX Eukaryota
ENOG4110RI8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003453

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG058387

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q80X50

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0GRY

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q80X50

TreeFam database of animal gene trees

More...
TreeFami
TF328468

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022166 DUF3697_Uba2
IPR015940 UBA
IPR009060 UBA-like_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12478 DUF3697, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00165 UBA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46934 SSF46934, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50030 UBA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q80X50-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMTSVGTNRA RGNWEQPQNQ NQTQHKQRPQ ATAEQIRLAQ MISDHNDADF
60 70 80 90 100
EEKVKQLIDI TGKNQDECVI ALHDCNGDVN RAINVLLEGN PDTHSWEMVG
110 120 130 140 150
KKKGVSGQKD GGQTESNEEG KENRDRDRDY SRRRGGPPRR GRGASRGREF
160 170 180 190 200
RGQENGLDGT KSGGPSGRGT DRGRRGRGRG RGSSGRRGGR FSAQGMGTFN
210 220 230 240 250
PADYAEPANT DDNYGNSSGN TWNNTGHFEP DDGTRLDFIG VEGSNYPRKF
260 270 280 290 300
ETAPGAWRTA TEEWGTEDWN EDLSETKIFT ASNVSSVPLP AENVTITAGQ
310 320 330 340 350
RIDLAVLLGK TPSSMENDSS NLDPSQAPSL AQPLVFSNSK QNAISQPASG
360 370 380 390 400
STFSHHSMVS MLGKGFGDVG EAKGGSTTGS QFLEQFKTAQ ALAQLAAQHS
410 420 430 440 450
QSGSTTTSSW DMGSTTQSPS LVQYDLKSAN DSTVHSPFTK RQAFTPSSTM
460 470 480 490 500
MEVFLQEKPP AVATSTAAPP PPSSPLPSKS TSAPQMSPGS SDNQSSSPQP
510 520 530 540 550
AQQKLKQQKK KTSLTSKIPA LAVEMPGSAD ISGLNLQFGA LQFGSEPVLS
560 570 580 590 600
DYESTPTTSA SSSQAPSSLY TSTASESSST VSSNQSQESG YQSGPIQSTT
610 620 630 640 650
YTSQNNAQGP LYEQRSTQTR RYPSSISSSP QKDLTQAKNG FSSVQATQLQ
660 670 680 690 700
TTQSVEGATG SAVKSESPST SSIPSLNETV PAASLLTTAN QHSSSLSGLS
710 720 730 740 750
HTEEIPNTTT TQHSSALSTQ QNTLSSSTSS GRTSTSTLLH TSVESEANLH
760 770 780 790 800
SSSSTFSTTS STVSAPPPVV SVSSSLNSGS SLGLSLGSNS TVTASTRSSV
810 820 830 840 850
ATTSGKAPPN LPPGVPPLLP NPYIMAPGLL HAYPPQVYGY DDLQMLQTRF
860 870 880 890 900
PLDYYSIPFP TPTTPLTGRD GSLASNPYSG DLTKFGRGDA SSPAPATTLA
910 920 930 940 950
QPQQNQTQTH HTTQQTFLNP ALPPGYSYTS LPYYTGVPGL PSTFQYGPAV
960 970 980 990 1000
FPVAPTSSKQ HGVNVSVNAS ATPFQQPSGY GSHGYNTGVS VTSSNTGVPD
1010 1020 1030 1040 1050
ISGSVYSKTQ QSFEKQGFHS GTPAASFNLP SALGSGGPIN PATAAAYPPA
1060 1070 1080 1090 1100
PFMHILTPHQ QPHSQILHHH LQQDGQTGSG QRSQTSSIPQ KPQTNKSAYN

SYSWGAN
Length:1,107
Mass (Da):116,799
Last modified:June 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF4A4FB502B619C51
GO
Isoform 2 (identifier: Q80X50-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-150: F → CMHGALSKPAVV
     989-1107: VSVTSSNTGV...AYNSYSWGAN → RKYPPPYKHFWTAES

Show »
Length:1,014
Mass (Da):107,242
Checksum:i7672DF250DB63179
GO
Isoform 3 (identifier: Q80X50-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     235-255: RLDFIGVEGSNYPRKFETAPG → S
     1077-1107: TGSGQRSQTSSIPQKPQTNKSAYNSYSWGAN → DILTLVDDQLGE

Show »
Length:1,068
Mass (Da):112,549
Checksum:i3645335AD2E03879
GO
Isoform 4 (identifier: Q80X50-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1077-1107: TGSGQRSQTSSIPQKPQTNKSAYNSYSWGAN → LPYLQMILCCQRQQEEQDILTLVDDQLGE

Show »
Length:1,105
Mass (Da):116,903
Checksum:i3DD82C85DE1B188A
GO
Isoform 5 (identifier: Q80X50-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     255-255: G → GMIHPG

Show »
Length:1,112
Mass (Da):117,335
Checksum:i3713A6AA077BD17B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2JDV6A0A0G2JDV6_MOUSE
Ubiquitin associated protein 2-like...
Ubap2l mCG_22226
1,067Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0H2UH17A0A0H2UH17_MOUSE
Ubiquitin associated protein 2-like...
Ubap2l mCG_22226
983Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JG47A0A0G2JG47_MOUSE
Ubiquitin-associated protein 2-like
Ubap2l
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JGD0A0A0G2JGD0_MOUSE
Ubiquitin-associated protein 2-like
Ubap2l
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JDT1A0A0G2JDT1_MOUSE
Ubiquitin-associated protein 2-like
Ubap2l
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JFN7A0A0G2JFN7_MOUSE
Ubiquitin-associated protein 2-like
Ubap2l
497Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JE24A0A0G2JE24_MOUSE
Ubiquitin-associated protein 2-like
Ubap2l
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JEC6A0A0G2JEC6_MOUSE
Ubiquitin-associated protein 2-like
Ubap2l
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC37777 differs from that shown. Reason: Frameshift at positions 444, 462 and 476.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti303D → G in BAC33295 (PubMed:16141072).Curated1
Sequence conflicti1010Missing in AAH23906 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti374G → S in strain: FVB/N. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019418150F → CMHGALSKPAVV in isoform 2. 1 Publication1
Alternative sequenceiVSP_019419235 – 255RLDFI…ETAPG → S in isoform 3. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_019420255G → GMIHPG in isoform 5. 1 Publication1
Alternative sequenceiVSP_019421989 – 1107VSVTS…SWGAN → RKYPPPYKHFWTAES in isoform 2. 1 PublicationAdd BLAST119
Alternative sequenceiVSP_0194221077 – 1107TGSGQ…SWGAN → DILTLVDDQLGE in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_0194231077 – 1107TGSGQ…SWGAN → LPYLQMILCCQRQQEEQDIL TLVDDQLGE in isoform 4. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK014274 mRNA Translation: BAB29236.1
AK048286 mRNA Translation: BAC33295.1
AK079895 mRNA Translation: BAC37777.1 Frameshift.
AK088702 mRNA Translation: BAC40514.1
BC023906 mRNA Translation: AAH23906.1
BC029075 mRNA Translation: AAH29075.1
BC050910 mRNA Translation: AAH50910.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS38498.1 [Q80X50-4]
CCDS50965.1 [Q80X50-2]
CCDS50966.1 [Q80X50-5]
CCDS79960.1 [Q80X50-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001159455.1, NM_001165983.1 [Q80X50-5]
NP_001159456.1, NM_001165984.1 [Q80X50-1]
NP_001159457.1, NM_001165985.1 [Q80X50-2]
NP_001159458.1, NM_001165986.1 [Q80X50-2]
NP_082751.1, NM_028475.2 [Q80X50-4]
XP_006502235.1, XM_006502172.2 [Q80X50-5]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.25610
Mm.441742

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000029553; ENSMUSP00000029553; ENSMUSG00000042520 [Q80X50-4]
ENSMUST00000064639; ENSMUSP00000066138; ENSMUSG00000042520 [Q80X50-5]
ENSMUST00000195995; ENSMUSP00000143638; ENSMUSG00000042520 [Q80X50-2]
ENSMUST00000196843; ENSMUSP00000143459; ENSMUSG00000042520 [Q80X50-1]
ENSMUST00000199834; ENSMUSP00000143254; ENSMUSG00000042520 [Q80X50-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
74383

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:74383

UCSC genome browser

More...
UCSCi
uc008qal.2 mouse [Q80X50-4]
uc008qam.2 mouse [Q80X50-3]
uc008qao.2 mouse [Q80X50-1]
uc008qap.2 mouse [Q80X50-5]
uc008qas.2 mouse [Q80X50-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK014274 mRNA Translation: BAB29236.1
AK048286 mRNA Translation: BAC33295.1
AK079895 mRNA Translation: BAC37777.1 Frameshift.
AK088702 mRNA Translation: BAC40514.1
BC023906 mRNA Translation: AAH23906.1
BC029075 mRNA Translation: AAH29075.1
BC050910 mRNA Translation: AAH50910.1
CCDSiCCDS38498.1 [Q80X50-4]
CCDS50965.1 [Q80X50-2]
CCDS50966.1 [Q80X50-5]
CCDS79960.1 [Q80X50-1]
RefSeqiNP_001159455.1, NM_001165983.1 [Q80X50-5]
NP_001159456.1, NM_001165984.1 [Q80X50-1]
NP_001159457.1, NM_001165985.1 [Q80X50-2]
NP_001159458.1, NM_001165986.1 [Q80X50-2]
NP_082751.1, NM_028475.2 [Q80X50-4]
XP_006502235.1, XM_006502172.2 [Q80X50-5]
UniGeneiMm.25610
Mm.441742

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WJ7NMR-A19-109[»]
ProteinModelPortaliQ80X50
SMRiQ80X50
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi216707, 10 interactors
IntActiQ80X50, 4 interactors
STRINGi10090.ENSMUSP00000066138

PTM databases

iPTMnetiQ80X50
PhosphoSitePlusiQ80X50

Proteomic databases

EPDiQ80X50
PaxDbiQ80X50
PeptideAtlasiQ80X50
PRIDEiQ80X50

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000029553; ENSMUSP00000029553; ENSMUSG00000042520 [Q80X50-4]
ENSMUST00000064639; ENSMUSP00000066138; ENSMUSG00000042520 [Q80X50-5]
ENSMUST00000195995; ENSMUSP00000143638; ENSMUSG00000042520 [Q80X50-2]
ENSMUST00000196843; ENSMUSP00000143459; ENSMUSG00000042520 [Q80X50-1]
ENSMUST00000199834; ENSMUSP00000143254; ENSMUSG00000042520 [Q80X50-2]
GeneIDi74383
KEGGimmu:74383
UCSCiuc008qal.2 mouse [Q80X50-4]
uc008qam.2 mouse [Q80X50-3]
uc008qao.2 mouse [Q80X50-1]
uc008qap.2 mouse [Q80X50-5]
uc008qas.2 mouse [Q80X50-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9898
MGIiMGI:1921633 Ubap2l

Phylogenomic databases

eggNOGiENOG410IGWX Eukaryota
ENOG4110RI8 LUCA
GeneTreeiENSGT00390000003453
HOVERGENiHBG058387
InParanoidiQ80X50
OrthoDBiEOG091G0GRY
PhylomeDBiQ80X50
TreeFamiTF328468

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ubap2l mouse
EvolutionaryTraceiQ80X50

Protein Ontology

More...
PROi
PR:Q80X50

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000042520 Expressed in 294 organ(s), highest expression level in embryonic stem cell
CleanExiMM_UBAP2L
ExpressionAtlasiQ80X50 baseline and differential
GenevisibleiQ80X50 MM

Family and domain databases

InterProiView protein in InterPro
IPR022166 DUF3697_Uba2
IPR015940 UBA
IPR009060 UBA-like_sf
PfamiView protein in Pfam
PF12478 DUF3697, 1 hit
SMARTiView protein in SMART
SM00165 UBA, 1 hit
SUPFAMiSSF46934 SSF46934, 1 hit
PROSITEiView protein in PROSITE
PS50030 UBA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUBP2L_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q80X50
Secondary accession number(s): Q8BIT6
, Q8BIW4, Q8BJ01, Q8CIG7, Q8K102, Q9CRT6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 1, 2003
Last modified: November 7, 2018
This is version 129 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again