Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 154 (02 Jun 2021)
Sequence version 1 (01 Jun 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Zinc finger and BTB domain-containing protein 24

Gene

Zbtb24

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in BMP2-induced transcription.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi159 – 171A.T hookAdd BLAST13
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri293 – 315C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri321 – 343C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri349 – 371C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri377 – 399C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri405 – 427C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri433 – 455C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri461 – 483C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri489 – 511C2H2-type 8PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger and BTB domain-containing protein 24
Alternative name(s):
Bone morphogenetic protein-induced factor 1
Brain-specific protein 1
Zinc finger protein 450
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Zbtb24
Synonyms:Bif1, Bsg1, Znf450
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:3039618, Zbtb24

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000477351 – 710Zinc finger and BTB domain-containing protein 24Add BLAST710

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q80X44

PRoteomics IDEntifications database

More...
PRIDEi
Q80X44

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
275124 [Q80X44-1]
275125 [Q80X44-2]
275126 [Q80X44-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q80X44

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q80X44

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Highest level in liver, testis and kidney.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By BMP2 in fibroblast, myoblast and preosteoblast cell lines.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000019826, Expressed in embryo and 271 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q80X44, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MN1.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
234478, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q80X44, 2 interactors

Molecular INTeraction database

More...
MINTi
Q80X44

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000079592

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q80X44, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1710
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q80X44

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini37 – 103BTBPROSITE-ProRule annotationAdd BLAST67

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni134 – 176DisorderedSequence analysisAdd BLAST43
Regioni202 – 256DisorderedSequence analysisAdd BLAST55
Regioni651 – 676DisorderedSequence analysisAdd BLAST26

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi202 – 254Basic and acidic residuesSequence analysisAdd BLAST53

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri293 – 315C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri321 – 343C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri349 – 371C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri377 – 399C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri405 – 427C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri433 – 455C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri461 – 483C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri489 – 511C2H2-type 8PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159373

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_024445_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q80X44

Identification of Orthologs from Complete Genome Data

More...
OMAi
QPEQMHV

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q80X44

TreeFam database of animal gene trees

More...
TreeFami
TF332049

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.710.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000210, BTB/POZ_dom
IPR011333, SKP1/BTB/POZ_sf
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00651, BTB, 1 hit
PF00096, zf-C2H2, 6 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00225, BTB, 1 hit
SM00355, ZnF_C2H2, 8 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54695, SSF54695, 1 hit
SSF57667, SSF57667, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50097, BTB, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 8 hits
PS50157, ZINC_FINGER_C2H2_2, 8 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q80X44-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADTTPEPCG QLMVHSDTHS DTVLASLEDQ RKKGFLCDIT LIVENVHFRA
60 70 80 90 100
HKALLAASSE YFSMMFAEEG EIGQSIYMLE GMVADTFGIL LEFIYTGYLH
110 120 130 140 150
ASEKTTEQIL ATAQFLKVYD LVKAYADFQD NHSAPKPPAL NCTGTPVVVI
160 170 180 190 200
SNKKNDPLKR KRGRPRKANG LQEGRSELAA EGELQLRVNN SVQNRQNFVF
210 220 230 240 250
KEEDSVKLSE QTPEDKESEP AGEPGSVEEV PAEKDENFDP KAGDGQESQS
260 270 280 290 300
RCSRRRIRRS VKLKDYKLLG DEDDQSTAKR LCGRKKRSSG PEARCKDCDR
310 320 330 340 350
VFKYSHFLAI HQRRHTGERP FKCNECGKGF AQKHSLQVHT RMHTGERPYT
360 370 380 390 400
CTVCGKALTT KHSLLEHMSL HSGQKSFTCD QCGKYFSQKR QLKSHYRVHT
410 420 430 440 450
GHSLPECSHC HRKFMDVSQL KKHLRTHTGE KPFTCEICGK SFTAKSSLQT
460 470 480 490 500
HIRIHRGEKP YSCSICGKCF SDSSAKRRHC ILHTGKKPFS CPECGLQFAR
510 520 530 540 550
LDNLKAHLKI HSKEKHTADS SSVSGSNVDE GRNILQLQPY QLSTSGEQEI
560 570 580 590 600
QLLVTDSVHN INFMPGPSQG VSIVAAESPQ SMATDPAANI TLLTQQPEQL
610 620 630 640 650
QGLILSAQQE QAEHIQSLSV IGGQMESSQT EPVHVITLSK ETLEHLHAHQ
660 670 680 690 700
EQTTSSVPAA DTGARATPVP STRPGAELTQ APLAVPLDPS PGATVAGWPF
710
GPSSYRSLKM
Length:710
Mass (Da):78,751
Last modified:June 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBB0533A274AFFF2D
GO
Isoform 2 (identifier: Q80X44-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     402-454: HSLPECSHCH...KSSLQTHIRI → TIPIRPLTTRMQPLPPKVYGRVPAEEAPADT

Show »
Length:688
Mass (Da):76,046
Checksum:i9B1A54292C2C0B1F
GO
Isoform 3 (identifier: Q80X44-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     318-354: ERPFKCNECGKGFAQKHSLQVHTRMHTGERPYTCTVC → NFDFQTWCDWLGSLELWLGRLCCFYMVDMAIKPSCCV
     355-710: Missing.

Show »
Length:354
Mass (Da):40,007
Checksum:i951524B28D7727FD
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_016223318 – 354ERPFK…TCTVC → NFDFQTWCDWLGSLELWLGR LCCFYMVDMAIKPSCCV in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_016224355 – 710Missing in isoform 3. 1 PublicationAdd BLAST356
Alternative sequenceiVSP_016225402 – 454HSLPE…THIRI → TIPIRPLTTRMQPLPPKVYG RVPAEEAPADT in isoform 2. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF263010 mRNA Translation: AAK91811.2
AY210402 mRNA Translation: AAO42998.1
AY210403 Genomic DNA Translation: AAO42999.1
AK054097 mRNA Translation: BAE20695.1
AK146986 mRNA Translation: BAE27589.1
BC050933 mRNA Translation: AAH50933.1
BC055367 mRNA Translation: AAH55367.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS23804.1 [Q80X44-1]
CCDS87996.1 [Q80X44-2]
CCDS87997.1 [Q80X44-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001264158.1, NM_001277229.1 [Q80X44-2]
NP_001264159.1, NM_001277230.1 [Q80X44-3]
NP_700447.2, NM_153398.3 [Q80X44-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000080771; ENSMUSP00000079592; ENSMUSG00000019826 [Q80X44-1]
ENSMUST00000213797; ENSMUSP00000148861; ENSMUSG00000019826 [Q80X44-2]
ENSMUST00000216656; ENSMUSP00000150197; ENSMUSG00000019826 [Q80X44-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
268294

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:268294

UCSC genome browser

More...
UCSCi
uc007exl.2, mouse [Q80X44-3]
uc007exm.2, mouse [Q80X44-1]
uc011xdb.2, mouse [Q80X44-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF263010 mRNA Translation: AAK91811.2
AY210402 mRNA Translation: AAO42998.1
AY210403 Genomic DNA Translation: AAO42999.1
AK054097 mRNA Translation: BAE20695.1
AK146986 mRNA Translation: BAE27589.1
BC050933 mRNA Translation: AAH50933.1
BC055367 mRNA Translation: AAH55367.1
CCDSiCCDS23804.1 [Q80X44-1]
CCDS87996.1 [Q80X44-2]
CCDS87997.1 [Q80X44-3]
RefSeqiNP_001264158.1, NM_001277229.1 [Q80X44-2]
NP_001264159.1, NM_001277230.1 [Q80X44-3]
NP_700447.2, NM_153398.3 [Q80X44-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6ML2X-ray1.87A375-519[»]
6ML3X-ray1.68A375-519[»]
6ML4X-ray1.48A375-519[»]
6ML5X-ray1.65A375-519[»]
6ML6X-ray1.54A375-519[»]
6ML7X-ray1.75A375-519[»]
SMRiQ80X44
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi234478, 2 interactors
IntActiQ80X44, 2 interactors
MINTiQ80X44
STRINGi10090.ENSMUSP00000079592

PTM databases

iPTMnetiQ80X44
PhosphoSitePlusiQ80X44

Proteomic databases

PaxDbiQ80X44
PRIDEiQ80X44
ProteomicsDBi275124 [Q80X44-1]
275125 [Q80X44-2]
275126 [Q80X44-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
56124, 112 antibodies

The DNASU plasmid repository

More...
DNASUi
268294

Genome annotation databases

EnsembliENSMUST00000080771; ENSMUSP00000079592; ENSMUSG00000019826 [Q80X44-1]
ENSMUST00000213797; ENSMUSP00000148861; ENSMUSG00000019826 [Q80X44-2]
ENSMUST00000216656; ENSMUSP00000150197; ENSMUSG00000019826 [Q80X44-3]
GeneIDi268294
KEGGimmu:268294
UCSCiuc007exl.2, mouse [Q80X44-3]
uc007exm.2, mouse [Q80X44-1]
uc011xdb.2, mouse [Q80X44-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9841
MGIiMGI:3039618, Zbtb24

Phylogenomic databases

eggNOGiKOG1721, Eukaryota
GeneTreeiENSGT00940000159373
HOGENOMiCLU_024445_0_0_1
InParanoidiQ80X44
OMAiQPEQMHV
OrthoDBi1318335at2759
PhylomeDBiQ80X44
TreeFamiTF332049

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
268294, 5 hits in 52 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Zbtb24, mouse

Protein Ontology

More...
PROi
PR:Q80X44
RNActiQ80X44, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000019826, Expressed in embryo and 271 other tissues
GenevisibleiQ80X44, MM

Family and domain databases

Gene3Di3.30.710.10, 1 hit
InterProiView protein in InterPro
IPR000210, BTB/POZ_dom
IPR011333, SKP1/BTB/POZ_sf
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type
PfamiView protein in Pfam
PF00651, BTB, 1 hit
PF00096, zf-C2H2, 6 hits
SMARTiView protein in SMART
SM00225, BTB, 1 hit
SM00355, ZnF_C2H2, 8 hits
SUPFAMiSSF54695, SSF54695, 1 hit
SSF57667, SSF57667, 4 hits
PROSITEiView protein in PROSITE
PS50097, BTB, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 8 hits
PS50157, ZINC_FINGER_C2H2_2, 8 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZBT24_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q80X44
Secondary accession number(s): Q3UIB7, Q7TPC4, Q8CJC9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 24, 2005
Last sequence update: June 1, 2003
Last modified: June 2, 2021
This is version 154 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again