Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 118 (12 Aug 2020)
Sequence version 2 (05 Apr 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Hydrocephalus-inducing protein

Gene

Hydin

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for ciliary motility.1 Publication

Caution

It is uncertain whether Met-1 or Met-56 is the initiator.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Hydrocephalus-inducing protein
Alternative name(s):
Protein Hy-3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Hydin
Synonyms:Hy3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2389007, Hydin

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell projection

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Defects in Hydin are the cause of spontaneous hydrocephalus 3, a lethal communicating hydrocephalus with perinatal onset. There is lethality in the first weeks of life because of hydrocephalus caused by abnormal ependymal ciliary motility. Cilia are unable to bend normally, ciliary beat frequency is reduced, and the cilia tend to stall. As a result, these cilia are incapable of generating fluid flow. Similar defects are observed for cilia in trachea. Mice do not exhibit randomization of left-right body asymmetry or situs inversus.2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002848451 – 5154Hydrocephalus-inducing proteinAdd BLAST5154

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q80W93

PRoteomics IDEntifications database

More...
PRIDEi
Q80W93

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q80W93

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q80W93

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain and testis. Expressed in ciliated epithelial cells lining bronchi and oviduct, and in spermatocytes.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

At 15 dpc, expressed in developing choroid plexus. At P0, brain expression is limited to the ciliated ependymal cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000059854, Expressed in testis and 52 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q80W93, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
232672, 4 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000046204

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q80W93, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q80W93

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1948 – 1977Sequence analysisAdd BLAST30
Coiled coili2308 – 2444Sequence analysisAdd BLAST137
Coiled coili2543 – 2588Sequence analysisAdd BLAST46

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QQ4F, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00610000086095

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000116_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q80W93

KEGG Orthology (KO)

More...
KOi
K17570

Identification of Orthologs from Complete Genome Data

More...
OMAi
AHLQMEV

Database of Orthologous Groups

More...
OrthoDBi
3322at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q80W93

TreeFam database of animal gene trees

More...
TreeFami
TF328687

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 20 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031549, ASH
IPR033305, Hydin-like
IPR033768, Hydin_ADK
IPR013783, Ig-like_fold
IPR008962, PapD-like_sf

The PANTHER Classification System

More...
PANTHERi
PTHR23053, PTHR23053, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15780, ASH, 1 hit
PF17213, Hydin_ADK, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49354, SSF49354, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q80W93-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTLKIKCVAN YIKEKIPNVL FLCDPEARLQ QLTASVPLCE QRKYFKQTNK
60 70 80 90 100
RLEESMGAMH RKMAKVISGL QSKVLPPMSP KVVTEEEVNR MLTPSEFLKE
110 120 130 140 150
MSLTTEQKLA STRIICRPQI TELLDMGETT HQKFSRVDLD QALFQPFPSE
160 170 180 190 200
IIFQNYSPCE VYEVPLVLRN NDKIPRMVKV VEESSPYFKI ISPKDIGHKV
210 220 230 240 250
APGVPSVFRI LFTPEENKDY AHMLTCITER EKFIVPVKAR GARAILDFPD
260 270 280 290 300
ELNFSTCPVK YNTQKVLLVR NIGNKDSMFH LKTRSPYSVE PTGGILNVGE
310 320 330 340 350
SMQLEVDFEP QTVGSHDGKL IVTYDTGEMV FVCLYGVAID VNIRLDKNSL
360 370 380 390 400
IMEKTYISLA NQRSITIHNR TNIIAHFQWK VFATEEEEDK EKYKICDGLN
410 420 430 440 450
KEEKQETSMI LEDSVLDPSL RERLSIISRT FENQRKLVQG DSMLFLDHVF
460 470 480 490 500
TIEPPEGDVW PNSSAEITVY FNPLEAKLYQ QTVYCDISGR EIRLPLRIRG
510 520 530 540 550
EGMGPKLHFN FELLDIGKVF IGSAHCYEAI LSNKGSIDAL FNVIPPTSAL
560 570 580 590 600
GACFVFNPKE GIIEPSGVQA VQISFSSTIL GYFEEEFLID VNGSPEPVKM
610 620 630 640 650
TIRGCVIGPT FHFNVPALNF GNVSYGFPHT LMCSLNNTSL VPMTFKLRVR
660 670 680 690 700
GDGEGMSSIP SYSQESDSKQ WSGINTEMPT TKPKEFTISP NSGTIRAQGF
710 720 730 740 750
TAIKVTLCSN TVQKYELALV VDVEGIGEEV LALLITARCV VPKLQLVTTE
760 770 780 790 800
VDFGRCFLKY PYEKTIQLVN HDDLPGCYKV LPQLYENSPP VLLSSPSPCG
810 820 830 840 850
VISPHSTVSI PLALETQVIG AHRSIVYISV FGSQEAPLAC NIQSIGEGPV
860 870 880 890 900
IFIHPTQIDF GNIYVLKDTS RILQLSNQSF IPAVFRVRMA NKKSLWTVKP
910 920 930 940 950
SEGAVPAEDD IPLTLTANLD DIVTFKDTVI LEIKHSNTYR IPIQATGIGS
960 970 980 990 1000
TIVSDKPFAP ELNLGAHFSL DTHYYRFKLT NKGRRVQQLF WMNDDFRPKE
1010 1020 1030 1040 1050
KQSKKEPGKK GSTSSSRRQS KASQEPTDNG NPVFQLYPVR MELYPGQTID
1060 1070 1080 1090 1100
VILEGYSATP KKVKEKLVCQ AIVGTQKGKS LLMSVNIICE FIAPIIQLSA
1110 1120 1130 1140 1150
KQLLYRLEKK PNSNLESDYQ SLVIKNITTL PVNMLLSTTR PFFICETDKS
1160 1170 1180 1190 1200
LLPATPKPIK LEVDEEKHLL IKFDPSYRND LNNWVAEEVL SIKYLEHPQV
1210 1220 1230 1240 1250
DNLGLRAEVH YPNLSFEVMD IDFGCILNDT EVIRYIMITN CSPLVVKFRW
1260 1270 1280 1290 1300
FFLVDEEENQ IRFAPCMKPY SAFLSQMESI AATSVTASSL AAPHTVEYTE
1310 1320 1330 1340 1350
MDFSDSIKTI LMDDEAGPEE IKKPATSTMV SEAIKYSSAG TERSQSQPDY
1360 1370 1380 1390 1400
PECMWIYEQD EMLSIGIEEV FDILPLYGVL RPYSSHQISF TFYGHCDIIA
1410 1420 1430 1440 1450
RAKALCEVEG GPTYEVLLKG EASLVNYSFD TKDINYGLQL FDHVTEREIT
1460 1470 1480 1490 1500
LKNTGKVGFE FNVLSNYRSS QRNLLPGVPL ILPLSGFIQS NKEQVLKVYY
1510 1520 1530 1540 1550
LPGIPEVFQR NFQIQIAHLV PENITLYGEG IFPRISLDLH RNLQGNEKYE
1560 1570 1580 1590 1600
HFLEQAKKNV EKEYTKYEAV DQYEVMAEEL PEEETAEISA HVQMEVERLI
1610 1620 1630 1640 1650
VQDYALEHQR SISNNTEDIY FSQRSCRKLT KVQLPEYILD FGYIVLGDVR
1660 1670 1680 1690 1700
THIVKITNTS HFPVSFHAEK QVLHETGFST ELDRVKNLPY YETETFEVRC
1710 1720 1730 1740 1750
DPQGANLPVG NKEVILPIKV YGGPTIHLCL QATVIIPSMT LSCNKIEFAT
1760 1770 1780 1790 1800
IQCGQCMVET IQLSNHLQVP CEWFVHTPKS TNKLDKHMPK YLRRKLQAEM
1810 1820 1830 1840 1850
IPKSRIFEIQ PTSGILDPGE RANVQVKFMP KEEKLYSQSL LFQIGQSSQK
1860 1870 1880 1890 1900
LTLLAQGQGL EPRLEFSPSV LELGPLLPFA SGDEAEVIVR NPCNFPIEFY
1910 1920 1930 1940 1950
SLEFDQQYLL EEKMLRQLKG YDSYNTLLLP PRNPGEKLPP EVYDYFKEMK
1960 1970 1980 1990 2000
KSKEEHMKAK YMENLENEEE EMNTSDQGTT STKRTSISRG ISVTSNLEER
2010 2020 2030 2040 2050
HLTIEAKNYL DEDDYEESLE KLTFQTDKMQ STDSHSVEEV GEVESNPVSK
2060 2070 2080 2090 2100
AIARHLGIDI SAEGRLAKNR KGIAIIVHGT PLSGKTANAI SMAKFYNAAC
2110 2120 2130 2140 2150
LNIDSIVLEA LSDTNNILGI RARELCIRAA IEQSMREAEE SAHESSMTQN
2160 2170 2180 2190 2200
TVVPARLSTE NLGRFTSELT LITQEYKVPK TVRGSVMLPK GKADSHFTGS
2210 2220 2230 2240 2250
QKQHHQHQSE TPQVQISSSP LLPGPTHRRL SVSASIGGET GLMSCVLPDD
2260 2270 2280 2290 2300
LLIQILAERI QLSNCFRGVV FDGLDTLFAR NAPSALHCLL KAIGSREHIY
2310 2320 2330 2340 2350
VINMSQDYVV MKAQEKAKKE QEENKRKEAL AKEKERLQTL DEDEYDALTA
2360 2370 2380 2390 2400
EEKVAFDRDV RQALRERKKR ELERLAKEMQ EKKLQQELER QKEEDELKRK
2410 2420 2430 2440 2450
VKRPKAGPAA KEEPPLKKAQ GATNKQLAAV AKIELKMESI ERKVSVREHA
2460 2470 2480 2490 2500
TLEETTRKKK AMTEYPLLIP ISQEQEDSEG DFLKDSDKNL AQKFKIYDMC
2510 2520 2530 2540 2550
LKDVQNILMY WDRKQGMMVP HTGTDEMSHE ADDQRQAPSG GGGRKGRKDR
2560 2570 2580 2590 2600
ERERLEKERA EKERLEREKA ERERLEKLKA LEERSDVEGE GEEEHEGKKD
2610 2620 2630 2640 2650
LGVPFINIQS PDFEGVSWKQ ALESDKLPKG DQILDILGLG SSGPPIPPPV
2660 2670 2680 2690 2700
LFSIISYPAK RQSLVATEIL KHFVFVIPPN DDIPLMDEKK DPEGDSDIFL
2710 2720 2730 2740 2750
NTIITKAQEE QPSPPKGSKQ KLKDKPEQVR ETQKEKRRTY SSRKGLPGGT
2760 2770 2780 2790 2800
SGSIVPMSDI DQNSFDGEHS QEKFIRLNHF RWIVPPNGEV TLRVHFSSLD
2810 2820 2830 2840 2850
VGNYDQTFNF ELLGTRRQYQ LYCRGVCTYP YICRDPKVVF SQRKKDMKLK
2860 2870 2880 2890 2900
EVVVKKYVVS MEKFYFGPLL CGKSRDKYKS SLFPGNMETL TILNDSPMVV
2910 2920 2930 2940 2950
EAYFCFQHDI KASTYFLEPV NMTLKPNEKQ ALNVWAYPTA VGIFEDSIVC
2960 2970 2980 2990 3000
CIKENPEPAI FKLSCQGIRP EIEVEPRQLH FDRLLLHRKE TKIVILRNVT
3010 3020 3030 3040 3050
PLPVAWRISN LEHLGEDFTV SMMQGTMLPK GEYGLQVHFQ PSKPVNIKKA
3060 3070 3080 3090 3100
IRIEVLDAEN LVGVVQIENI LIFAESYDIA LDITFPKGAE GGLDFGTLRV
3110 3120 3130 3140 3150
MEEVKQTLQL KNRGKYEIIF SFTVDTLGVL PTNLSSMISV QPKRGTLASI
3160 3170 3180 3190 3200
DKPTTVQVFF RARKEVKIDC QPILRCQIIE PTLPEGEIIA SIPIKFSVNA
3210 3220 3230 3240 3250
VYSKFTISPS SIINFGALIC GTRKSITFTI ENQGIIDFKY ALYRLTGESP
3260 3270 3280 3290 3300
ILQKKITSHM RHGRTRESES FYKPGATKMA KFSDTVQKDT NIANQARFTH
3310 3320 3330 3340 3350
GMFTVYPGFG SIPSGGQQVI TIECFADPVG RCEEFLAIDI SDRDPRENPA
3360 3370 3380 3390 3400
GIPYTLLAEA CLPAFVTDNN ILIFEEHQIC TSPNLYHILQ TIQSGGLFVE
3410 3420 3430 3440 3450
DENKFIFCNV LVGHQAKARF KISNVGKISC DINIVIKPIS NKPANRITDT
3460 3470 3480 3490 3500
FDVEPSKMCI GSRSHAFVTV LFTPQTMQTY QCIFEATLDG LPSNIARSRG
3510 3520 3530 3540 3550
LVFDIVGEGT LPRVTVIRPT LYNQHGNPLL LFKRLLLGHS EKLPLILKNN
3560 3570 3580 3590 3600
GTIPAQLHVD LRDQLGVFSL KGRPTTSYIY IMEENKPNEK VKKAHTASLV
3610 3620 3630 3640 3650
VSPGDTAEFD VFFHSNKIGR MTGTIHLSVI NNQYEETMIH LVGESYEDDI
3660 3670 3680 3690 3700
TLDNIHGLIS STSQESSDKS EVIEIAEEST MEDLVTAALM EHIQFGYCHI
3710 3720 3730 3740 3750
GISYNVSFTI TNHSQVNVIR FEWPLLATLS FSPQIGHLHP GCSKDVVVTL
3760 3770 3780 3790 3800
KSESPITLKK MCVKCKLSKI MFQLPVDQVP DWDDRMRTVK WVDAPRNTPL
3810 3820 3830 3840 3850
TLNTKRKVIE MDPEPAHSVV EENYRELRIQ FSANVDFASY QCETTEVFFK
3860 3870 3880 3890 3900
ETLVYQTRVF EFDLVNTGQV LLEFCWISEE ASKAVSFAMP ERQGSSQKEL
3910 3920 3930 3940 3950
SQGSGSSLDS ALDRWTEASP SPFSVEPPSG VVPVGKTQKL KVKFSPMDIG
3960 3970 3980 3990 4000
EFESSLYCQI PNLPLGEQGP ILITKGRSVL PFCHFDLKES DYISGHRRNP
4010 4020 4030 4040 4050
ELRGPGAGPL EPNTRVIEFT SVGIGGKNVQ TFTILNPTNS TYSFCWTSEE
4060 4070 4080 4090 4100
TESLQHPPAF VCLTEKGIIH PEKKAEIIFQ FLPAHLDITE EFWTFSIPEH
4110 4120 4130 4140 4150
NISVPFLLVG KTTDPLISLD KSHLNFSSLL IGREARETVK IINKEEQGFN
4160 4170 4180 4190 4200
FAFQDNSRYS EGFNNSLIVC PMEGWIPPLS RFPVDIFFTP KQEGDVNFNL
4210 4220 4230 4240 4250
ICNIKKKAHP LTLNVKAEGY TMNAEVKCRD RMGTTILLTS TQVNTINFYE
4260 4270 4280 4290 4300
VELNECVQCE FSFINTGKFN FSYQAELSGP KLLLQYLDFT PTDSSVDVGQ
4310 4320 4330 4340 4350
SEPANLSFQP YQKCVLKGLE LKIKISHGPT FVCNILGCAV SPAVHFSFTS
4360 4370 4380 4390 4400
HNFGTCFIYQ AGMPPYKQIL VVTNKEETSM SLDCLYTNTP HIEVNFNVDV
4410 4420 4430 4440 4450
IKPGKTLEIP ITFYPREAIS YRELIPFEIN GLSQQTVEIK GKGTEMKLLV
4460 4470 4480 4490 4500
LDPANRIVKL GAVLPGQVVR KTVSLVNNSL AQLTFNHSVL FSIPELQEAK
4510 4520 4530 4540 4550
VITLEPFHTI TMKPKEVCKL EITFAPKKRV PPFSEEVFME WMGLLRPLFL
4560 4570 4580 4590 4600
LSGCCQALEI SLDQEHLPFG PVVYQTQATR RILIMNTGDV GARFKWDVKK
4610 4620 4630 4640 4650
LKPHFSISPE EGYIISGTEV ALEVTYHPTE IGKESLYKNI LCFIQGGNPL
4660 4670 4680 4690 4700
CLTLSGTCVG PPVVKEVVNF NCQVRSRHTQ TILLSNRSNQ TWNLHPIFEG
4710 4720 4730 4740 4750
EHWEGPEFIT LEAHQQNKPY EITYKPRTMN LENRKHQGTL FFPLPDGTGW
4760 4770 4780 4790 4800
LYALHGTAEL PKAVANIYRE VPCKTPYTEL LPISNWLNKP QRFRVIVEIL
4810 4820 4830 4840 4850
KPEKTDLSVT LKGLDYIDVL SGSKKDYKLN FFSYKEGLYT AKVIFRNEVT
4860 4870 4880 4890 4900
NEFLYYTVSF RVTPSGIIKT IQMTSPVRQS VSASIKLENP LPYSVTFSTE
4910 4920 4930 4940 4950
CKLSDISLPS QFAVPPNSEG TFSFEFQPLK AGELCGRLTL HNSDLGYYQY
4960 4970 4980 4990 5000
ELALKALPAP PEKPVHFQTV LGSSQSILAK FTNYTRLKTE YYCKTDCSDF
5010 5020 5030 5040 5050
HTEKVINAAP GAQGGTEVSV EVFFEPSHLG ETKGILCLSS LIGGEYIIPL
5060 5070 5080 5090 5100
FGIALPPKPQ GPFLIRAGYN IIIPFKNVFL HATSFSFIVE NPAFSIRAAE
5110 5120 5130 5140 5150
TVRPKKINNI TVYFEGNPSG SKTPITSKLI VTCPQCEGTE SGIKWVYYLK

GITP
Length:5,154
Mass (Da):581,523
Last modified:April 5, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i64BD17692EAFD2BA
GO
Isoform 2 (identifier: Q80W93-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1333-1333: A → V
     1334-5154: Missing.

Show »
Length:1,333
Mass (Da):149,957
Checksum:i61CF56D6A1E4E16F
GO
Isoform 3 (identifier: Q80W93-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MTLKIKCVANYIKEKIPNVLFLCDPEARLQQLTASVPL → MDSAVQQKVARKKCRD
     489-501: GREIRLPLRIRGE → VRSTEDGILGPLQ
     502-5154: Missing.

Show »
Length:479
Mass (Da):54,897
Checksum:i4F8BD2891282B69E
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAO44953 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAC26807 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BB664150 differs from that shown. Contaminating sequence. Sequence of unknown origin in the C-terminal part.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti97F → S in BB641870 (PubMed:16141072).Curated1
Sequence conflicti107Q → H in BB641870 (PubMed:16141072).Curated1
Sequence conflicti190I → M in BAE25238 (PubMed:16141072).Curated1
Sequence conflicti1264A → T in BAE25238 (PubMed:16141072).Curated1
Sequence conflicti4370L → F in AAH80316 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0409151 – 38MTLKI…ASVPL → MDSAVQQKVARKKCRD in isoform 3. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_040916489 – 501GREIR…RIRGE → VRSTEDGILGPLQ in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_040917502 – 5154Missing in isoform 3. 1 PublicationAdd BLAST4653
Alternative sequenceiVSP_0247011333A → V in isoform 2. 1 Publication1
Alternative sequenceiVSP_0247021334 – 5154Missing in isoform 2. 1 PublicationAdd BLAST3821

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY173049 mRNA Translation: AAO44953.1 Different initiation.
AK030144 mRNA Translation: BAC26807.1 Different initiation.
AK043971 mRNA Translation: BAC31720.1
AK142981 mRNA Translation: BAE25238.1
BB641870 mRNA No translation available.
BB664150 mRNA No translation available.
BC080316 mRNA Translation: AAH80316.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS40476.1 [Q80W93-1]

NCBI Reference Sequences

More...
RefSeqi
NP_766504.3, NM_172916.2 [Q80W93-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000043141; ENSMUSP00000046204; ENSMUSG00000059854 [Q80W93-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
244653

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:244653

UCSC genome browser

More...
UCSCi
uc009nkq.1, mouse [Q80W93-3]
uc009nkr.1, mouse [Q80W93-2]
uc009nks.1, mouse [Q80W93-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY173049 mRNA Translation: AAO44953.1 Different initiation.
AK030144 mRNA Translation: BAC26807.1 Different initiation.
AK043971 mRNA Translation: BAC31720.1
AK142981 mRNA Translation: BAE25238.1
BB641870 mRNA No translation available.
BB664150 mRNA No translation available.
BC080316 mRNA Translation: AAH80316.1
CCDSiCCDS40476.1 [Q80W93-1]
RefSeqiNP_766504.3, NM_172916.2 [Q80W93-1]

3D structure databases

SMRiQ80W93
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi232672, 4 interactors
STRINGi10090.ENSMUSP00000046204

PTM databases

iPTMnetiQ80W93
PhosphoSitePlusiQ80W93

Proteomic databases

PaxDbiQ80W93
PRIDEiQ80W93

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
66504, 41 antibodies

Genome annotation databases

EnsembliENSMUST00000043141; ENSMUSP00000046204; ENSMUSG00000059854 [Q80W93-1]
GeneIDi244653
KEGGimmu:244653
UCSCiuc009nkq.1, mouse [Q80W93-3]
uc009nkr.1, mouse [Q80W93-2]
uc009nks.1, mouse [Q80W93-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54768
MGIiMGI:2389007, Hydin

Phylogenomic databases

eggNOGiENOG502QQ4F, Eukaryota
GeneTreeiENSGT00610000086095
HOGENOMiCLU_000116_1_0_1
InParanoidiQ80W93
KOiK17570
OMAiAHLQMEV
OrthoDBi3322at2759
PhylomeDBiQ80W93
TreeFamiTF328687

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
244653, 3 hits in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Hydin, mouse

Protein Ontology

More...
PROi
PR:Q80W93
RNActiQ80W93, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000059854, Expressed in testis and 52 other tissues
GenevisibleiQ80W93, MM

Family and domain databases

Gene3Di2.60.40.10, 20 hits
InterProiView protein in InterPro
IPR031549, ASH
IPR033305, Hydin-like
IPR033768, Hydin_ADK
IPR013783, Ig-like_fold
IPR008962, PapD-like_sf
PANTHERiPTHR23053, PTHR23053, 1 hit
PfamiView protein in Pfam
PF15780, ASH, 1 hit
PF17213, Hydin_ADK, 1 hit
SUPFAMiSSF49354, SSF49354, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHYDIN_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q80W93
Secondary accession number(s): Q3UQ06
, Q68ED1, Q8BRL9, Q8CDF4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: April 5, 2011
Last modified: August 12, 2020
This is version 118 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again