Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Small G protein signaling modulator 2

Gene

Sgsm2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Possesses GTPase activator activity towards RAB32, RAB33B and RAB38. Regulates the trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes by inactivating RAB32 and RAB38. Inhibits RAB32 and RAB38 activation both directly by promoting their GTPase activity and indirectly by disrupting the RAB9A-HPS4 interaction which is required for RAB32/38 activation (PubMed:26620560).1 Publication

GO - Molecular functioni

  • GTPase activator activity Source: UniProtKB
  • Rab GTPase binding Source: MGI

GO - Biological processi

Keywordsi

Molecular functionGTPase activation

Names & Taxonomyi

Protein namesi
Recommended name:
Small G protein signaling modulator 2
Alternative name(s):
RUN and TBC1 domain-containing protein 1
Gene namesi
Name:Sgsm2
Synonyms:Kiaa0397, Rutbc1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:2144695 Sgsm2

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002846631 – 1005Small G protein signaling modulator 2Add BLAST1005

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei402PhosphoserineCombined sources1
Isoform 2 (identifier: Q80U12-2)
Modified residuei444PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ80U12
PeptideAtlasiQ80U12
PRIDEiQ80U12

PTM databases

iPTMnetiQ80U12
PhosphoSitePlusiQ80U12

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSMUSG00000038351 Expressed in 209 organ(s), highest expression level in brain
CleanExiMM_SGSM2
GenevisibleiQ80U12 MM

Interactioni

Subunit structurei

Interacts with RAB4A, RAB11A, RAP1A, RAP1B, RAP2A and RAP2B. No interaction with RAB27A. Interacts with RAB9A (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi220852, 3 interactors
DIPiDIP-61071N
IntActiQ80U12, 2 interactors
STRINGi10090.ENSMUSP00000050496

Structurei

3D structure databases

ProteinModelPortaliQ80U12
SMRiQ80U12
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini34 – 191RUNPROSITE-ProRule annotationAdd BLAST158
Domaini566 – 938Rab-GAP TBCPROSITE-ProRule annotationAdd BLAST373

Domaini

The Rab-GAP TBC domain possesses GTPase activator activity.By similarity

Sequence similaritiesi

Belongs to the RUTBC family.Curated

Phylogenomic databases

eggNOGiKOG1648 Eukaryota
COG5210 LUCA
GeneTreeiENSGT00550000074386
HOGENOMiHOG000007057
HOVERGENiHBG108483
InParanoidiQ80U12
KOiK21851
OMAiFLATHPI
OrthoDBiEOG091G01KZ
PhylomeDBiQ80U12
TreeFamiTF318216

Family and domain databases

CDDicd15784 PH_RUTBC, 1 hit
InterProiView protein in InterPro
IPR000195 Rab-GTPase-TBC_dom
IPR035969 Rab-GTPase_TBC_sf
IPR004012 Run_dom
IPR037213 Run_dom_sf
IPR037745 SGSM1/2
PfamiView protein in Pfam
PF00566 RabGAP-TBC, 1 hit
PF02759 RUN, 1 hit
SMARTiView protein in SMART
SM00593 RUN, 1 hit
SM00164 TBC, 1 hit
SUPFAMiSSF140741 SSF140741, 1 hit
SSF47923 SSF47923, 2 hits
PROSITEiView protein in PROSITE
PS50826 RUN, 1 hit
PS50086 TBC_RABGAP, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q80U12-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSAEDAVKE KLLWNVKKEV KQIMEEAVTR KFVHEDSSHI IALCGAVEAC
60 70 80 90 100
LLHQLRRRAA GFLRSDKMAA LFTKVGKTCP VAEDICHKVQ ELQQQAEGRK
110 120 130 140 150
PSGGSQEALR KQGSTGGKAP ALSPQALKHI WVRTALMEKV LDRVVQYLAE
160 170 180 190 200
NCSKYYEKEA LLADPVFGPI LACLLVGPCA LEYTKLKTAD HYWTDPSADE
210 220 230 240 250
LVQRHRIRGP PNRQDSPAKR PALGIRKRHS SGSASEDRLA ACAREYVESL
260 270 280 290 300
HQNSRTRLLY GKNNVLVQPK EDMEAVPGYL SLHQSAENLT LKWTPNQLMN
310 320 330 340 350
GTLGDSELEK SVYWDYALVV PFSQIVCIHC HQQKSGGTLV LVSQDGIQRP
360 370 380 390 400
PLHFPQGGHL LSFLSCLENG LLPRGQLEPP LWTQQGKGKV FPKLRKRSSI
410 420 430 440 450
RSIDVEELGV GRATDYVFRI IYPGHRHEHN AGDMIEMQGF GPSLTAWHLE
460 470 480 490 500
PLCSQGSSCL SCSSSSSPYA TPSHCSCIPD RLPLRLLCES MKRQIVSRAF
510 520 530 540 550
YGWLAYCRHL STVRTHLSAL VHHNIIPPDR PPGASGGLTK DVWSKYQKDE
560 570 580 590 600
KNYKELELLR QVYYGGVEHE IRKDVWPFLL GHYKFGMSKK EMEQVDTAVA
610 620 630 640 650
ARYQQVLAEW KACEVVVRQR EREAHPATLT KFSSGSSIDS HVQRLVHRDS
660 670 680 690 700
TISNDVFISV DDLEPSGPQD LEDSKPKREQ EPGAGTPGIA AAEQQSVEFD
710 720 730 740 750
SPDSGLPSSR NYSVASGIQS SLDEAQSVGF EDDGAGEDGS EGPATAAHTF
760 770 780 790 800
PGPHDPGQET LAPASELEAG QELAAVCAAA YTIELLDTVA LNLHRIDKDV
810 820 830 840 850
QRCDRNYWYF TTSNLERLRD IMCSYVWEHL DMGYVQGMCD LLAPLLVILD
860 870 880 890 900
NDQLAYSCFS HLMKRMGQNF PSGGAMDSHF ANMRSLIQIL DSELFELMHQ
910 920 930 940 950
NGDYTHFYFC YRWFLLDFKR ELLYEDVFAV WEVIWAARRI SSEHFVLFIA
960 970 980 990 1000
LALVEAYREI IRDNNMDFTD IIKFFNERAE RHDAQEILRI ARDLVHKVQM

LIDNK
Length:1,005
Mass (Da):113,076
Last modified:April 17, 2007 - v2
Checksum:i5902EC20348D031F
GO
Isoform 2 (identifier: Q80U12-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     430-430: N → ITINYHHLAASRAASVDDDEEEEDKLHAMLSMICSRNLTAPNPMKD

Note: Gene prediction based on similarity to human ortholog. No experimental confirmation available.Combined sources
Show »
Length:1,050
Mass (Da):118,099
Checksum:i237DCC61FD8EDD69
GO

Sequence cautioni

The sequence AAH58414 differs from that shown. Reason: Frameshift at position 936.Curated
The sequence AAH60163 differs from that shown. Reason: Frameshift at position 936.Curated
The sequence BAC65555 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024599430N → ITINYHHLAASRAASVDDDE EEEDKLHAMLSMICSRNLTA PNPMKD in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122273 mRNA Translation: BAC65555.1 Different initiation.
AL604066 Genomic DNA No translation available.
BC058414 mRNA Translation: AAH58414.1 Frameshift.
BC060163 mRNA Translation: AAH60163.1 Frameshift.
CCDSiCCDS36224.1 [Q80U12-1]
RefSeqiNP_922934.2, NM_197943.2 [Q80U12-1]
XP_006534644.1, XM_006534581.3 [Q80U12-2]
UniGeneiMm.245894

Genome annotation databases

EnsembliENSMUST00000057631; ENSMUSP00000050496; ENSMUSG00000038351 [Q80U12-1]
ENSMUST00000081799; ENSMUSP00000080489; ENSMUSG00000038351 [Q80U12-2]
GeneIDi97761
KEGGimmu:97761
UCSCiuc007kck.1 mouse [Q80U12-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122273 mRNA Translation: BAC65555.1 Different initiation.
AL604066 Genomic DNA No translation available.
BC058414 mRNA Translation: AAH58414.1 Frameshift.
BC060163 mRNA Translation: AAH60163.1 Frameshift.
CCDSiCCDS36224.1 [Q80U12-1]
RefSeqiNP_922934.2, NM_197943.2 [Q80U12-1]
XP_006534644.1, XM_006534581.3 [Q80U12-2]
UniGeneiMm.245894

3D structure databases

ProteinModelPortaliQ80U12
SMRiQ80U12
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi220852, 3 interactors
DIPiDIP-61071N
IntActiQ80U12, 2 interactors
STRINGi10090.ENSMUSP00000050496

PTM databases

iPTMnetiQ80U12
PhosphoSitePlusiQ80U12

Proteomic databases

PaxDbiQ80U12
PeptideAtlasiQ80U12
PRIDEiQ80U12

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000057631; ENSMUSP00000050496; ENSMUSG00000038351 [Q80U12-1]
ENSMUST00000081799; ENSMUSP00000080489; ENSMUSG00000038351 [Q80U12-2]
GeneIDi97761
KEGGimmu:97761
UCSCiuc007kck.1 mouse [Q80U12-1]

Organism-specific databases

CTDi9905
MGIiMGI:2144695 Sgsm2
RougeiSearch...

Phylogenomic databases

eggNOGiKOG1648 Eukaryota
COG5210 LUCA
GeneTreeiENSGT00550000074386
HOGENOMiHOG000007057
HOVERGENiHBG108483
InParanoidiQ80U12
KOiK21851
OMAiFLATHPI
OrthoDBiEOG091G01KZ
PhylomeDBiQ80U12
TreeFamiTF318216

Miscellaneous databases

ChiTaRSiSgsm2 mouse
PROiPR:Q80U12
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000038351 Expressed in 209 organ(s), highest expression level in brain
CleanExiMM_SGSM2
GenevisibleiQ80U12 MM

Family and domain databases

CDDicd15784 PH_RUTBC, 1 hit
InterProiView protein in InterPro
IPR000195 Rab-GTPase-TBC_dom
IPR035969 Rab-GTPase_TBC_sf
IPR004012 Run_dom
IPR037213 Run_dom_sf
IPR037745 SGSM1/2
PfamiView protein in Pfam
PF00566 RabGAP-TBC, 1 hit
PF02759 RUN, 1 hit
SMARTiView protein in SMART
SM00593 RUN, 1 hit
SM00164 TBC, 1 hit
SUPFAMiSSF140741 SSF140741, 1 hit
SSF47923 SSF47923, 2 hits
PROSITEiView protein in PROSITE
PS50826 RUN, 1 hit
PS50086 TBC_RABGAP, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSGSM2_MOUSE
AccessioniPrimary (citable) accession number: Q80U12
Secondary accession number(s): Q5SWE0, Q5SWE1, Q6PAP8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: April 17, 2007
Last modified: November 7, 2018
This is version 106 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again