Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 133 (02 Dec 2020)
Sequence version 2 (23 Oct 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Zinc finger protein 423

Gene

Znf423

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor that can both act as an activator or a repressor depending on the context. Plays a central role in BMP signaling and olfactory neurogenesis. Associates with SMADs in response to BMP2 leading to activate transcription of BMP target genes. Acts as a transcriptional repressor via its interaction with EBF1, a transcription factor involved in terminal olfactory receptor neurons differentiation; this interaction preventing EBF1 to bind DNA and activate olfactory-specific genes. Involved in olfactory neurogenesis by participating in a developmental switch that regulates the transition from differentiation to maturation in olfactory receptor neurons. Controls proliferation and differentiation of neural precursors in cerebellar vermis formation.4 Publications

Miscellaneous

Znf423 gene is a frequent target of retroviral integration in murine B-cell lymphomas.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri75 – 101C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST27
Zinc fingeri146 – 168C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri174 – 196C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri202 – 224C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri230 – 252C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri271 – 294C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri303 – 326C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri331 – 353C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri417 – 441C2H2-type 9; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri449 – 472C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri488 – 511C2H2-type 11PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri525 – 548C2H2-type 12PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri571 – 596C2H2-type 13; atypicalPROSITE-ProRule annotationAdd BLAST26
Zinc fingeri640 – 662C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri670 – 692C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri700 – 723C2H2-type 16PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri728 – 751C2H2-type 17PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri758 – 781C2H2-type 18PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri789 – 811C2H2-type 19PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri815 – 838C2H2-type 20PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri894 – 916C2H2-type 21; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri938 – 960C2H2-type 22PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri967 – 989C2H2-type 23PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1028 – 1050C2H2-type 24PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1072 – 1090C2H2-type 25; degeneratePROSITE-ProRule annotationAdd BLAST19
Zinc fingeri1128 – 1151C2H2-type 26PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1176 – 1198C2H2-type 27PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1206 – 1228C2H2-type 28PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1237 – 1260C2H2-type 29PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1267 – 1290C2H2-type 30PROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Developmental protein, DNA-binding, Repressor
Biological processDifferentiation, Neurogenesis, Transcription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 423
Alternative name(s):
Early B-cell factor-associated zinc finger protein
Olf1/EBF-associated zinc finger protein
Smad- and Olf-interacting zinc finger protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Znf423
Synonyms:Ebfaz, Kiaa0760, Nur12, Oaz, Zfp423
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1891217, Zfp423

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice are runted and ataxic, the cerebellum is underdeveloped, and the vermis is severely reduced, resulting in diminished proliferation by granule cell precursors in the external germinal layer, especially near the midline, and abnormal differentiation and migration of ventricular zone-derived neurons and Bergmann glia. In the remaining cerebellar structures, the Purkinje cells are poorly developed and mislocalized.2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003085961 – 1292Zinc finger protein 423Add BLAST1292

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei55PhosphoserineBy similarity1
Modified residuei58PhosphoserineBy similarity1
Modified residuei612PhosphoserineBy similarity1
Modified residuei1062PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q80TS5

PRoteomics IDEntifications database

More...
PRIDEi
Q80TS5

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q80TS5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q80TS5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Within the cerebellum, Zfp423 is expressed in both ventricular and external germinal zones. Transiently expressed in newly differentiating olfactory-receptor neurons.3 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

During embryogenesis, it is highly expressed at the dorsal neuroepithelium flanking the roof plate.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000045333, Expressed in embryonic post-anal tail and 273 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q80TS5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q80TS5, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (By similarity).

Interacts with SMAD1 and SMAD4.

Interacts with EBF1 (By similarity).

Interacts with PARP1.

Interacts with CEP290 (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
220465, 42 interactors

Protein interaction database and analysis system

More...
IntActi
Q80TS5, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000105282

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q80TS5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
Q80TS5

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q80TS5

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Uses different DNA- and protein-binding zinc fingers to regulate the distinct BMP-Smad and Olf signaling pathways. C2H2-type zinc fingers 14-19 mediate the interaction with SMAD1 and SMAD4, while zinc fingers 28-30 mediate the interaction with EBF1. zinc fingers 2-8 bind the 5'-CCGCCC-3' DNA sequence in concert with EBF1, while zinc fingers 9-13 bind BMP target gene promoters in concert with SMADs (By similarity).By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri75 – 101C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST27
Zinc fingeri146 – 168C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri174 – 196C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri202 – 224C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri230 – 252C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri271 – 294C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri303 – 326C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri331 – 353C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri417 – 441C2H2-type 9; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri449 – 472C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri488 – 511C2H2-type 11PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri525 – 548C2H2-type 12PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri571 – 596C2H2-type 13; atypicalPROSITE-ProRule annotationAdd BLAST26
Zinc fingeri640 – 662C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri670 – 692C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri700 – 723C2H2-type 16PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri728 – 751C2H2-type 17PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri758 – 781C2H2-type 18PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri789 – 811C2H2-type 19PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri815 – 838C2H2-type 20PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri894 – 916C2H2-type 21; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri938 – 960C2H2-type 22PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri967 – 989C2H2-type 23PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1028 – 1050C2H2-type 24PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1072 – 1090C2H2-type 25; degeneratePROSITE-ProRule annotationAdd BLAST19
Zinc fingeri1128 – 1151C2H2-type 26PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1176 – 1198C2H2-type 27PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1206 – 1228C2H2-type 28PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1237 – 1260C2H2-type 29PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1267 – 1290C2H2-type 30PROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158492

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q80TS5

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q80TS5

TreeFam database of animal gene trees

More...
TreeFami
TF331504

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096, zf-C2H2, 6 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355, ZnF_C2H2, 30 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667, SSF57667, 10 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028, ZINC_FINGER_C2H2_1, 27 hits
PS50157, ZINC_FINGER_C2H2_2, 23 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q80TS5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRRKQAKPR SVKVEEGEAS DFSLAWDSSV AAAGGLEGEP ECDRKTSRAL
60 70 80 90 100
EDRNSVTSQE ERNEDDEDVE DESIYTCDHC QQDFESLADL TDHRAHRCPG
110 120 130 140 150
DGDDDPQLSW VASSPSSKDV ASPTQMIGDG CDLGLGEEEG GTGLPYPCQF
160 170 180 190 200
CDKSFIRLSY LKRHEQIHSD KLPFKCTFCS RLFKHKRSRD RHIKLHTGDK
210 220 230 240 250
KYHCHECEAA FSRSDHLKIH LKTHSSSKPF KCSVCKRGFS STSSLQSHMQ
260 270 280 290 300
AHKKNKEHLA KSEKEAKKDD FMCDYCEDTF SQTEELEKHV LTLHPQLSEK
310 320 330 340 350
ADLQCIHCPE VFVDESTLLA HIHQAHANQK HKCPMCPEQF SSVEGVYCHL
360 370 380 390 400
DSHRQPDSSN HSVSPDPVLG SVASMSSATP DSSASVERGS TPDSTLKPLR
410 420 430 440 450
GQKKMRDDGQ SWPKVVYSCP YCSKRDFTSL AVLEIHLKTI HADKPQQSHT
460 470 480 490 500
CQICLDSMPT LYNLNEHVRK LHKSHAYPVM QFGNISAFHC NYCPEMFADI
510 520 530 540 550
NSLQEHIRVS HCGPNANPPD GNNAFFCNQC SMGFLTESSL TEHIQQAHCS
560 570 580 590 600
VGSTKLESPV VQPTQSFMEV YSCPYCTNSP IFGSILKLTK HIKENHKNIP
610 620 630 640 650
LAHSKKSKAE QSPVSSDVEV SSPKRQRLSG SANSISNGEY PCNQCDLKFS
660 670 680 690 700
NFESFQTHLK LHLELLLRKQ ACPQCKEDFD SQESLLQHLT VHYMTTSTHY
710 720 730 740 750
VCESCDKQFS SVDDLQKHLL DMHTFVLYHC TLCQEVFDSK VSIQVHLAVK
760 770 780 790 800
HSNEKKMYRC TACNWDFRKE ADLQVHVKHS HLGNPAKAHK CIFCGETFST
810 820 830 840 850
EVELQCHITT HSKKYNCRFC SKAFHAVILL EKHLREKHCV FDAAAENGTA
860 870 880 890 900
NGVPPTSTKK AEPADLQGML LKNPEAPNSH EASEDDVDAS EPMYGCDICG
910 920 930 940 950
AAYTMEVLLQ NHRLRDHNIR PGEDDGSRKK AEFIKGSHKC NVCSRTFFSE
960 970 980 990 1000
NGLREHLQTH RGPAKHYMCP ICGERFPSLL TLTEHKVTHS KSLDTGTCRI
1010 1020 1030 1040 1050
CKMPLQSEEE FIEHCQMHPD LRNSLTGFRC VVCMQTVTST LELKIHGTFH
1060 1070 1080 1090 1100
MQKLAGSSAA SSPNGQGLQK LYKCALCLKE FRSKQDLVRL DVNGLPYGLC
1110 1120 1130 1140 1150
AGCMARSANG QVGGLAPPEP ADRPCAGLRC PECNVKFESA EDLESHMQVD
1160 1170 1180 1190 1200
HRDLTPETSG PRKGAQTSPV PRKKTYQCIK CQMTFENERE IQIHVANHMI
1210 1220 1230 1240 1250
EEGINHECKL CNQMFDSPAK LLCHLIEHSF EGMGGTFKCP VCFTVFVQAN
1260 1270 1280 1290
KLQQHIFAVH GQEDKIYDCS QCPQKFFFQT ELQNHTMSQH AQ
Length:1,292
Mass (Da):145,351
Last modified:October 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6E0EE26DDCF65E63
GO
Isoform 2 (identifier: Q80TS5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MSRRKQAKPRSVKVEEGEASDFSLAWDSSVAAA → MTGAERGPLCYH

Show »
Length:1,271
Mass (Da):143,090
Checksum:i773ADBC9915C9E0C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3UZP1G3UZP1_MOUSE
Zinc finger protein 423
Zfp423
244Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UW89G3UW89_MOUSE
Zinc finger protein 423
Zfp423
1,167Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UYI9G3UYI9_MOUSE
Zinc finger protein 423
Zfp423
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG17053 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH59234 differs from that shown. Chimeric cDNA.Curated
The sequence BAC65647 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti735E → K in AAG17053 (Ref. 4) Curated1
Sequence conflicti1182Q → R in AAP33073 (PubMed:15048087).Curated1
Sequence conflicti1182Q → R in AAN39840 (PubMed:15048087).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0290081 – 33MSRRK…SVAAA → MTGAERGPLCYH in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY147407 mRNA Translation: AAN39840.1
AY256893 mRNA Translation: AAP33073.1
AK122365 mRNA Translation: BAC65647.1 Different initiation.
BC059234 mRNA Translation: AAH59234.1 Sequence problems.
BC139028 mRNA Translation: AAI39029.1
BC139030 mRNA Translation: AAI39031.1
AF188609 mRNA Translation: AAG17053.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS52627.1 [Q80TS5-1]

NCBI Reference Sequences

More...
RefSeqi
NP_201584.2, NM_033327.2 [Q80TS5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000052250; ENSMUSP00000052379; ENSMUSG00000045333 [Q80TS5-2]
ENSMUST00000109655; ENSMUSP00000105282; ENSMUSG00000045333 [Q80TS5-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
94187

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:94187

UCSC genome browser

More...
UCSCi
uc009mqv.1, mouse [Q80TS5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY147407 mRNA Translation: AAN39840.1
AY256893 mRNA Translation: AAP33073.1
AK122365 mRNA Translation: BAC65647.1 Different initiation.
BC059234 mRNA Translation: AAH59234.1 Sequence problems.
BC139028 mRNA Translation: AAI39029.1
BC139030 mRNA Translation: AAI39031.1
AF188609 mRNA Translation: AAG17053.1 Different initiation.
CCDSiCCDS52627.1 [Q80TS5-1]
RefSeqiNP_201584.2, NM_033327.2 [Q80TS5-1]

3D structure databases

BMRBiQ80TS5
SMRiQ80TS5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi220465, 42 interactors
IntActiQ80TS5, 2 interactors
STRINGi10090.ENSMUSP00000105282

PTM databases

iPTMnetiQ80TS5
PhosphoSitePlusiQ80TS5

Proteomic databases

PaxDbiQ80TS5
PRIDEiQ80TS5

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
Q80TS5, 1 sequenced antibody

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
28187, 101 antibodies

Genome annotation databases

EnsembliENSMUST00000052250; ENSMUSP00000052379; ENSMUSG00000045333 [Q80TS5-2]
ENSMUST00000109655; ENSMUSP00000105282; ENSMUSG00000045333 [Q80TS5-1]
GeneIDi94187
KEGGimmu:94187
UCSCiuc009mqv.1, mouse [Q80TS5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
94187
MGIiMGI:1891217, Zfp423

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG1721, Eukaryota
GeneTreeiENSGT00940000158492
InParanoidiQ80TS5
OrthoDBi1318335at2759
PhylomeDBiQ80TS5
TreeFamiTF331504

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
94187, 1 hit in 17 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Zfp423, mouse

Protein Ontology

More...
PROi
PR:Q80TS5
RNActiQ80TS5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000045333, Expressed in embryonic post-anal tail and 273 other tissues
ExpressionAtlasiQ80TS5, baseline and differential
GenevisibleiQ80TS5, MM

Family and domain databases

InterProiView protein in InterPro
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type
PfamiView protein in Pfam
PF00096, zf-C2H2, 6 hits
SMARTiView protein in SMART
SM00355, ZnF_C2H2, 30 hits
SUPFAMiSSF57667, SSF57667, 10 hits
PROSITEiView protein in PROSITE
PS00028, ZINC_FINGER_C2H2_1, 27 hits
PS50157, ZINC_FINGER_C2H2_2, 23 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN423_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q80TS5
Secondary accession number(s): B2RSW4
, Q6PCP2, Q6X497, Q8CIQ1, Q9ESD2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: December 2, 2020
This is version 133 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again