Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 134 (12 Aug 2020)
Sequence version 2 (02 Sep 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Nischarin

Gene

Nisch

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts either as the functional imidazoline-1 receptor (I1R) candidate or as a membrane-associated mediator of the I1R signaling. Binds numerous imidazoline ligands that induces initiation of cell-signaling cascades triggering to cell survival, growth and migration. Its activation by the agonist rilmenidine induces an increase in phosphorylation of mitogen-activated protein kinases MAPK1 and MAPK3 in rostral ventrolateral medulla (RVLM) neurons that exhibited rilmenidine-evoked hypotension (By similarity). Blocking its activation with efaroxan abolished rilmenidine-induced mitogen-activated protein kinase phosphorylation in RVLM neurons (By similarity). Acts as a modulator of Rac-regulated signal transduction pathways. Suppresses Rac1-stimulated cell migration by interacting with PAK1 and inhibiting its kinase activity. Also blocks Pak-independent Rac signaling by interacting with RAC1 and inhibiting Rac1-stimulated NF-kB response element and cyclin D1 promoter activation. Inhibits also LIMK1 kinase activity by reducing LIMK1 'Tyr-508' phosphorylation. Inhibits Rac-induced cell migration and invasion in breast and colon epithelial cells. Inhibits lamellipodia formation, when overexpressed. Plays a role in protection against apoptosis (By similarity). Involved in association with IRS4 in the enhancement of insulin activation of MAPK1 and MAPK3 (By similarity). When overexpressed, induces a redistribution of cell surface ITGA5 integrin to intracellular endosomal structures (By similarity).By similarity6 Publications

Miscellaneous

'Nischarin' means 'slowness of motion' in classic Sanskrit.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processApoptosis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nischarin
Alternative name(s):
Imidazoline receptor 1
Short name:
I-1
Short name:
IR1
Imidazoline receptor I-1-like protein
Imidazoline-1 receptor
Short name:
I1R
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nisch
Synonyms:Kiaa0975
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1928323, Nisch

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endosome, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003482661 – 1593NischarinAdd BLAST1593

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei543PhosphoserineCombined sources1
Modified residuei545PhosphoserineCombined sources1
Modified residuei548PhosphoserineCombined sources1
Modified residuei1371PhosphothreonineCombined sources1
Modified residuei1373PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q80TM9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q80TM9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q80TM9

PeptideAtlas

More...
PeptideAtlasi
Q80TM9

PRoteomics IDEntifications database

More...
PRIDEi
Q80TM9

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q80TM9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q80TM9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in brain and kidney. Moderately expressed in heart, liver, lung and skeletal muscle. Not detected in spleen and testis.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in embryo at 7 day dpc onwards.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000021910, Expressed in saccule of membranous labyrinth and 318 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q80TM9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q80TM9, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homooligomer (By similarity).

Interacts with GRB2 (By similarity).

Interacts with PIK3R1; probably associates with the PI3-kinase complex (By similarity).

Interacts with IRS4 (By similarity).

Found in a complex with ITGA5 and PAK1.

Found in a complex with LIMK1 and PAK1.

Interacts with ITGA5 (via cytoplasmic domain); this interaction is direct.

Interacts with PAK1 (via kinase domain); this interaction is direct and is increased upon activation of PAK1.

Interacts with LIMK1 (via PDZ and kinase domain); this interaction is direct.

Interacts with LIMK2; this interaction depends on LIMK2 activity.

Interacts with RAC1 (activated state).

Interacts with STK11; this interaction may increase STK11 activity (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
211089, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q80TM9, 4 interactors

Molecular INTeraction database

More...
MINTi
Q80TM9

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000022469

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q80TM9, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini12 – 122PXPROSITE-ProRule annotationAdd BLAST111
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati290 – 311LRR 1Add BLAST22
Repeati313 – 334LRR 2Add BLAST22
Repeati335 – 356LRR 3Add BLAST22
Repeati358 – 379LRR 4Add BLAST22
Repeati380 – 401LRR 5Add BLAST22
Repeati405 – 426LRR 6Add BLAST22
Repeati1081 – 108616
Repeati1087 – 109226
Repeati1093 – 109836
Repeati1099 – 110446
Repeati1105 – 111056
Repeati1111 – 111666
Repeati1123 – 112876
Repeati1129 – 113486
Repeati1135 – 114096
Repeati1141 – 1146106

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 134Necessary for binding to phosphoinositide-3-P; not sufficient for targeting to endosomesBy similarityAdd BLAST134
Regioni121 – 695Necessary for homooligomerization and targeting to endosomesBy similarityAdd BLAST575
Regioni246 – 869Interaction with PAK11 PublicationAdd BLAST624
Regioni661 – 869Interaction with LIMKAdd BLAST209
Regioni709 – 807Interaction with ITGA5Add BLAST99
Regioni1081 – 114610 X 6 AA tandem repeat of A-E-A-P-A-AAdd BLAST66

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili624 – 694Sequence analysisAdd BLAST71

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi631 – 691Glu-richAdd BLAST61
Compositional biasi1041 – 1193Ala/Pro-richAdd BLAST153

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Both the presence of the PX domain and the coiled coil region are necessary for its endosomal targeting.By similarity

Keywords - Domaini

Coiled coil, Leucine-rich repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1259, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156494

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_252294_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q80TM9

KEGG Orthology (KO)

More...
KOi
K24095

Identification of Orthologs from Complete Genome Data

More...
OMAi
LDEDYVH

Database of Orthologous Groups

More...
OrthoDBi
320361at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q80TM9

TreeFam database of animal gene trees

More...
TreeFami
TF320547

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06875, PX_IRAS, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.1520.10, 1 hit
3.80.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001611, Leu-rich_rpt
IPR025875, Leu-rich_rpt_4
IPR032675, LRR_dom_sf
IPR037904, Nischarin_PX
IPR001683, Phox
IPR036871, PX_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12799, LRR_4, 1 hit
PF00787, PX, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00312, PX, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF64268, SSF64268, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51450, LRR, 6 hits
PS50195, PX, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q80TM9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAATLSFGP EREAEPAKEA RVVGSELVDT YTVYVIQVTD GNHEWTIKHR
60 70 80 90 100
YSDFHDLHEK LVAERKIDKS LLPPKKIIGK NSRSLVEKRE RDLEVYLQTL
110 120 130 140 150
LTTFPDVAPR VLAHFLHFHL YEVNGVTAAL AEELFEKGEQ LLGAGEVFAI
160 170 180 190 200
RPLQLYAITE QLQQGKPTCA SGDAKTDLGH ILDFTCRLKY LKVSGTEGPF
210 220 230 240 250
GTSNIKEQLL PFDLSIFKSL HQVEISHCDA KHIRGLVTSK PTLATMSVRF
260 270 280 290 300
SATSMKEVLA PEASEFDEWE PEGTATLGGP VTAIIPTWQA LTTLDLSHNS
310 320 330 340 350
ICEIDESVKL IPKIEYLDLS HNGLRVVDNL QHLYNLVHLD LSYNKLSSLE
360 370 380 390 400
GVHTKLGNVK TLNLAGNFLE SLSGLHKLYS LVNVDLRDNR IEQLDEVKSI
410 420 430 440 450
GSLPCLERLT LLNNPLSIIP DYRTKVLSQF GERASEICLD DVATTEKELD
460 470 480 490 500
TVEVLKAIQK AKDVKSKLSN TEKKAGEDFR LPPAPCIRPG GSPPAAPASA
510 520 530 540 550
SLPQPILSNQ GIMFVQEEAL ASSLSSTDSL PPEDHRPIAR ACSDSLESIP
560 570 580 590 600
AGQVASDDLR DVPGAVGGVS PDHAEPEVQV VPGSGQIIFL PFTCIGYTAT
610 620 630 640 650
NQDFIQRLST LIRQAIERQL PAWIEAANQR EEAHGEQGEE EEEEEEEEDV
660 670 680 690 700
AENRYFEMGP PDAEEEEGSG QGEEDEEDED EEAEEERLAL EWALGADEDF
710 720 730 740 750
LLEHIRILKV LWCFLIHVQG SIRQFAACLV LTDFGIAVFE IPHQESRGSS
760 770 780 790 800
QHILSSLRFV FCFPHGDLTE FGFLMPELCL VLKVRHSENT LFIISDAANL
810 820 830 840 850
HEFHADLRSC FAPQHMAMLC SPILYGSHTT LQEFLRQLLT FYKVAGGSQE
860 870 880 890 900
RSQGCFPVYL VYSDKRMVQT PAGDYSGNIE WASCTLCSAV RRSCCAPSEA
910 920 930 940 950
VKSAAIPYWL LLTSQHLNVI KADFNPMPNR GTHNCRNRNS FKLSRVPLST
960 970 980 990 1000
VLLDPTRSCT QPRGAFADGH VLELLVGYRF VTAIFVLPHE KFHFLRVYNQ
1010 1020 1030 1040 1050
LRASLQDLKT VVISKNPSAK PRNQPAKSRA SAEQRLQETP ADAPAPAAVP
1060 1070 1080 1090 1100
PTASAPAPAE ALAPDLAPVQ APGEDRGLTS AEAPAAAEAP AAAEAPAAAE
1110 1120 1130 1140 1150
APAAAEAPAA AEAPAAAEAP APAEAPAAAE APAAAEAPAA AEAPAAAEAP
1160 1170 1180 1190 1200
ASAEAPAPNQ APAPARGPAP ARGPAPAGGP APAEALAQAE VPAQYPSERL
1210 1220 1230 1240 1250
IQSTSEENQI PSHLPVCPSL QHIARLRGRA IIDLFHNSIA EVENEELRHL
1260 1270 1280 1290 1300
LWSSVVFYQT PGLEVTACVL LSSKAVYFIL HDGLRRYFSE PLQDFWHQKN
1310 1320 1330 1340 1350
TDYNNSPFHV SQCFVLKLSD LQSVNVGLFD QYFRLTGSSP TQVVTCLTRD
1360 1370 1380 1390 1400
SYLTHCFLQH LMLVLSSLER TPSPEPVDKD FYSEFGDKNT GKMENYELIH
1410 1420 1430 1440 1450
SSRVKFTYPS EEEVGDLTYI VAQKMADPAK NPALSILLYI QAFQVVTPHL
1460 1470 1480 1490 1500
GRGRGPLRPK TLLLTSAEIF LLDEDYIHYP LPEFAKEPPQ RDRYRLDDGR
1510 1520 1530 1540 1550
RVRDLDRVLM GYYPYPQALT LVFDDTQGHD LMGSVTLDHF GEMPGGPGRV
1560 1570 1580 1590
GQGREVQWQV FVPSAESREK LISLLARQWE ALCGRELPVE LTG
Length:1,593
Mass (Da):175,012
Last modified:September 2, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i90B407A165A4C1F8
GO
Isoform 2 (identifier: Q80TM9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     348-500: Missing.

Show »
Length:1,440
Mass (Da):158,425
Checksum:i8FFFBF697A5BEA01
GO
Isoform 3 (identifier: Q80TM9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-245: Missing.

Show »
Length:1,348
Mass (Da):147,611
Checksum:i9F92EED9E2342519
GO
Isoform 4 (identifier: Q80TM9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-472: ICLDDVATTEKELDTVEVLKAIQKAKDVKSKLSNTE → VSPRSSSRAQRDWQGKPSLSAKADRGKAVHSVLVFF
     473-1593: Missing.

Show »
Length:472
Mass (Da):52,609
Checksum:i115AB01516952992
GO
Isoform 5 (identifier: Q80TM9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     332-334: HLY → ATS
     335-1593: Missing.

Show »
Length:334
Mass (Da):37,131
Checksum:i00B86B5695E19BB7
GO
Isoform 6 (identifier: Q80TM9-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     513-516: MFVQ → LGDE
     517-1593: Missing.

Show »
Length:516
Mass (Da):57,033
Checksum:i95AF24DEBE8B6BF9
GO
Isoform 7 (identifier: Q80TM9-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     122-153: EVNGVTAALAEELFEKGEQLLGAGEVFAIRPL → VSSFGALCFAYEPTATKAVGLGFEETQTGPWP
     154-1593: Missing.

Show »
Length:153
Mass (Da):17,328
Checksum:i4E902C8FBC992DE7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6ZL22F6ZL22_MOUSE
Nischarin
Nisch
45Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6ZL69F6ZL69_MOUSE
Nischarin
Nisch
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7AFP3F7AFP3_MOUSE
Nischarin
Nisch
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6YR29F6YR29_MOUSE
Nischarin
Nisch
333Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7AVB2F7AVB2_MOUSE
Nischarin
Nisch
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH03270 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI08365 differs from that shown. Reason: Frameshift.Curated
The sequence AAK52087 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC65694 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti607R → P in BAC65694 (PubMed:12693553).Curated1
Sequence conflicti1123 – 1128Missing in BAC65694 (PubMed:12693553).Curated6
Sequence conflicti1172R → RGPAPAG in AAG42100 (PubMed:11121431).Curated1
Sequence conflicti1518A → G in AAK52087 (Ref. 6) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0351361 – 245Missing in isoform 3. 1 PublicationAdd BLAST245
Alternative sequenceiVSP_035137122 – 153EVNGV…AIRPL → VSSFGALCFAYEPTATKAVG LGFEETQTGPWP in isoform 7. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_035138154 – 1593Missing in isoform 7. 1 PublicationAdd BLAST1440
Alternative sequenceiVSP_035139332 – 334HLY → ATS in isoform 5. 1 Publication3
Alternative sequenceiVSP_035140335 – 1593Missing in isoform 5. 1 PublicationAdd BLAST1259
Alternative sequenceiVSP_035141348 – 500Missing in isoform 2. 1 PublicationAdd BLAST153
Alternative sequenceiVSP_035142437 – 472ICLDD…LSNTE → VSPRSSSRAQRDWQGKPSLS AKADRGKAVHSVLVFF in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_035143473 – 1593Missing in isoform 4. 1 PublicationAdd BLAST1121
Alternative sequenceiVSP_035144513 – 516MFVQ → LGDE in isoform 6. 1 Publication4
Alternative sequenceiVSP_035145517 – 1593Missing in isoform 6. 1 PublicationAdd BLAST1077

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF315344 mRNA Translation: AAG42100.1
AK122412 mRNA Translation: BAC65694.1 Different initiation.
AK036043 mRNA Translation: BAC29286.1
AK080441 mRNA Translation: BAC37917.1
AK086880 mRNA Translation: BAC39757.1
AC108416 Genomic DNA No translation available.
AC154446 Genomic DNA No translation available.
BC003270 mRNA Translation: AAH03270.1 Different initiation.
BC108364 mRNA Translation: AAI08365.1 Frameshift.
AY032852 mRNA Translation: AAK52087.1 Different initiation.
AF144133 mRNA Translation: AAD31521.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS36853.1 [Q80TM9-1]
CCDS84107.1 [Q80TM9-6]

NCBI Reference Sequences

More...
RefSeqi
NP_073147.2, NM_022656.2 [Q80TM9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000022469; ENSMUSP00000022469; ENSMUSG00000021910 [Q80TM9-1]
ENSMUST00000164989; ENSMUSP00000126982; ENSMUSG00000021910 [Q80TM9-5]
ENSMUST00000165981; ENSMUSP00000130210; ENSMUSG00000021910 [Q80TM9-4]
ENSMUST00000168206; ENSMUSP00000132842; ENSMUSG00000021910 [Q80TM9-3]
ENSMUST00000171735; ENSMUSP00000127132; ENSMUSG00000021910 [Q80TM9-7]
ENSMUST00000172142; ENSMUSP00000132413; ENSMUSG00000021910 [Q80TM9-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
64652

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:64652

UCSC genome browser

More...
UCSCi
uc007swy.1, mouse [Q80TM9-1]
uc007sxa.1, mouse [Q80TM9-6]
uc007sxb.1, mouse [Q80TM9-4]
uc007sxc.1, mouse [Q80TM9-7]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF315344 mRNA Translation: AAG42100.1
AK122412 mRNA Translation: BAC65694.1 Different initiation.
AK036043 mRNA Translation: BAC29286.1
AK080441 mRNA Translation: BAC37917.1
AK086880 mRNA Translation: BAC39757.1
AC108416 Genomic DNA No translation available.
AC154446 Genomic DNA No translation available.
BC003270 mRNA Translation: AAH03270.1 Different initiation.
BC108364 mRNA Translation: AAI08365.1 Frameshift.
AY032852 mRNA Translation: AAK52087.1 Different initiation.
AF144133 mRNA Translation: AAD31521.1
CCDSiCCDS36853.1 [Q80TM9-1]
CCDS84107.1 [Q80TM9-6]
RefSeqiNP_073147.2, NM_022656.2 [Q80TM9-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi211089, 3 interactors
IntActiQ80TM9, 4 interactors
MINTiQ80TM9
STRINGi10090.ENSMUSP00000022469

PTM databases

iPTMnetiQ80TM9
PhosphoSitePlusiQ80TM9

Proteomic databases

EPDiQ80TM9
jPOSTiQ80TM9
PaxDbiQ80TM9
PeptideAtlasiQ80TM9
PRIDEiQ80TM9

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
14512, 98 antibodies

The DNASU plasmid repository

More...
DNASUi
64652

Genome annotation databases

EnsembliENSMUST00000022469; ENSMUSP00000022469; ENSMUSG00000021910 [Q80TM9-1]
ENSMUST00000164989; ENSMUSP00000126982; ENSMUSG00000021910 [Q80TM9-5]
ENSMUST00000165981; ENSMUSP00000130210; ENSMUSG00000021910 [Q80TM9-4]
ENSMUST00000168206; ENSMUSP00000132842; ENSMUSG00000021910 [Q80TM9-3]
ENSMUST00000171735; ENSMUSP00000127132; ENSMUSG00000021910 [Q80TM9-7]
ENSMUST00000172142; ENSMUSP00000132413; ENSMUSG00000021910 [Q80TM9-6]
GeneIDi64652
KEGGimmu:64652
UCSCiuc007swy.1, mouse [Q80TM9-1]
uc007sxa.1, mouse [Q80TM9-6]
uc007sxb.1, mouse [Q80TM9-4]
uc007sxc.1, mouse [Q80TM9-7]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
11188
MGIiMGI:1928323, Nisch

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG1259, Eukaryota
GeneTreeiENSGT00940000156494
HOGENOMiCLU_252294_0_0_1
InParanoidiQ80TM9
KOiK24095
OMAiLDEDYVH
OrthoDBi320361at2759
PhylomeDBiQ80TM9
TreeFamiTF320547

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
64652, 5 hits in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Nisch, mouse

Protein Ontology

More...
PROi
PR:Q80TM9
RNActiQ80TM9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000021910, Expressed in saccule of membranous labyrinth and 318 other tissues
ExpressionAtlasiQ80TM9, baseline and differential
GenevisibleiQ80TM9, MM

Family and domain databases

CDDicd06875, PX_IRAS, 1 hit
Gene3Di3.30.1520.10, 1 hit
3.80.10.10, 2 hits
InterProiView protein in InterPro
IPR001611, Leu-rich_rpt
IPR025875, Leu-rich_rpt_4
IPR032675, LRR_dom_sf
IPR037904, Nischarin_PX
IPR001683, Phox
IPR036871, PX_dom_sf
PfamiView protein in Pfam
PF12799, LRR_4, 1 hit
PF00787, PX, 1 hit
SMARTiView protein in SMART
SM00312, PX, 1 hit
SUPFAMiSSF64268, SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS51450, LRR, 6 hits
PS50195, PX, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNISCH_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q80TM9
Secondary accession number(s): Q2YDV7
, Q8C354, Q8C4X9, Q8CBH0, Q91XW6, Q99LG6, Q9EPW8, Q9WUM6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: September 2, 2008
Last modified: August 12, 2020
This is version 134 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again