Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 161 (18 Sep 2019)
Sequence version 3 (27 Jul 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Erbin

Gene

Erbin

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as an adapter for the receptor ERBB2, in epithelia. By binding the unphosphorylated ERBB2 'Tyr-1248' receptor, it may contribute to stabilize this unphosphorylated state (By similarity). Inhibits NOD2-dependent NF-kappa-B signaling and proinflammatory cytokine secretion (PubMed:16203728).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-1227986 Signaling by ERBB2
R-MMU-8863795 Downregulation of ERBB2 signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Erbin1 Publication
Alternative name(s):
Densin-180-like protein
Erbb2-interacting protein1 Publication
Protein LAP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Erbin1 Publication
Synonyms:Erbb2ipImported, Kiaa1225Imported, Lap2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1890169 Erbin

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi315P → L: Decreases interaction with NOD2. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001883021 – 1402ErbinAdd BLAST1402

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei440PhosphoserineCombined sources1
Modified residuei444PhosphoserineCombined sources1
Modified residuei483PhosphotyrosineCombined sources1
Modified residuei485PhosphothreonineBy similarity1
Modified residuei595PhosphoserineCombined sources1
Modified residuei599PhosphoserineCombined sources1
Modified residuei600PhosphoserineCombined sources1
Modified residuei617PhosphoserineBy similarity1
Modified residuei712PhosphoserineCombined sources1
Modified residuei849PhosphoserineCombined sources1
Modified residuei854PhosphoserineCombined sources1
Modified residuei869PhosphoserineCombined sources1
Modified residuei914PhosphothreonineBy similarity1
Modified residuei917PhosphotyrosineBy similarity1
Modified residuei928PhosphoserineBy similarity1
Modified residuei970PhosphotyrosineBy similarity1
Modified residuei1097PhosphotyrosineCombined sources1
Modified residuei1150PhosphoserineCombined sources1
Modified residuei1171PhosphoserineBy similarity1
Modified residuei1276PhosphoserineBy similarity1
Isoform 2 (identifier: Q80TH2-2)
Modified residuei1231PhosphoserineCombined sources1
Modified residuei1234PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform 2 is phosphorylated on Ser-1231 and Ser-1234.

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q80TH2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q80TH2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q80TH2

PRoteomics IDEntifications database

More...
PRIDEi
Q80TH2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q80TH2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q80TH2

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q80TH2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000021709 Expressed in 274 organ(s), highest expression level in submandibular gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q80TH2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q80TH2 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ERBB2, BPAG1 and ITGB4. May favor the localization of ERBB2, by restricting its presence to the basolateral membrane of epithelial cells. Also found to interact with ARVCF and delta catenin.

Interacts (via C-terminus) with DST (via N-terminus) (By similarity).

Interacts with NOD2 (via CARD domain) (PubMed:16203728).

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
208523, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q80TH2, 3 interactors

Molecular INTeraction database

More...
MINTi
Q80TH2

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000140536

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati23 – 44LRR 1Add BLAST22
Repeati47 – 68LRR 2Add BLAST22
Repeati70 – 91LRR 3Add BLAST22
Repeati93 – 114LRR 4Add BLAST22
Repeati116 – 137LRR 5Add BLAST22
Repeati139 – 161LRR 6Add BLAST23
Repeati162 – 183LRR 7Add BLAST22
Repeati185 – 206LRR 8Add BLAST22
Repeati208 – 229LRR 9Add BLAST22
Repeati231 – 252LRR 10Add BLAST22
Repeati254 – 275LRR 11Add BLAST22
Repeati277 – 298LRR 12Add BLAST22
Repeati300 – 321LRR 13Add BLAST22
Repeati323 – 344LRR 14Add BLAST22
Repeati346 – 367LRR 15Add BLAST22
Repeati369 – 391LRR 16Add BLAST23
Repeati392 – 413LRR 17Add BLAST22
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1311 – 1400PDZPROSITE-ProRule annotationAdd BLAST90

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi928 – 931Poly-Ser4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the LAP (LRR and PDZ) protein family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410KCZ0 Eukaryota
COG4886 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159526

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q80TH2

KEGG Orthology (KO)

More...
KOi
K12796

Identification of Orthologs from Complete Genome Data

More...
OMAi
FHYGSSR

Database of Orthologous Groups

More...
OrthoDBi
100824at2759

TreeFam database of animal gene trees

More...
TreeFami
TF351429

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.80.10.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032927 Erbin
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf

The PANTHER Classification System

More...
PANTHERi
PTHR23119:SF46 PTHR23119:SF46, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13855 LRR_8, 4 hits
PF00595 PDZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00369 LRR_TYP, 12 hits
SM00228 PDZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51450 LRR, 13 hits
PS50106 PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: Q80TH2-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTTKRSLFVR LVPCRCLRGE EETVTTLDYS HCSLEQVPKE IFTFEKTLEE
60 70 80 90 100
LYLDANQIEE LPKQLFNCQS LHKLSLPDND LTTLPASIAN LINLRELDVS
110 120 130 140 150
KNGIQEFPEN IKNCKVLTIV EASVNPISKL PDGFSQLLNL TQLYLNDAFL
160 170 180 190 200
EFLPANFGRL TKLQILELRE NQLKMLPKTM NRLTQLERLD LGSNEFTEVP
210 220 230 240 250
EVLEQLSGLR EFWMDGNRLT FIPGFIGSLR QLTYLDVSKN NIEMVEEGIS
260 270 280 290 300
TCENLQDFLL SSNSLQQLPE TIGSLKNVTT LKIDENQLMY LPDSIGGLRS
310 320 330 340 350
IEELDCSFNE IEALPSSIGQ LTNMRTFAAD HNYLQQLPPE IGNWKNITVL
360 370 380 390 400
FLHCNKLETL PEEMGDMQKL KVINLSDNRL KNLPFSFTKL QQLTAMWLSD
410 420 430 440 450
NQSKPLIPLQ KETDTETQKM VLTNYMFPQQ PRTEDVMFIS DNESFNPALW
460 470 480 490 500
EEQRKQRAQV AFECDEDKDE REAPPREGNL KRYPTPYPDE LKNMVKTVQT
510 520 530 540 550
IVHRLKDEET NEESGRDLKQ HEDQQVVNKD KCVKTSESTT TKSKLDEREK
560 570 580 590 600
YMNSVQKMSE PEAETNGGNL PVTASMKLSG NLKHIVNHDD VFEESEELSS
610 620 630 640 650
DEEMKMAEMR PPLIESSINQ PKVVALSNNK KDDAKDADSL SDEVTHNSNQ
660 670 680 690 700
NNSNCSSPSR MSDSVSLNTD SSQDTSLCSP VKQTPVDSNS KVRQEDENFN
710 720 730 740 750
SLLQNGVNLN NSPEEKFKIN DKKDFKLPEY DLNIEEQLVL IEKDIDSKAT
760 770 780 790 800
SDDSRQLDHI NMNINKLVTN NIFQPEVMER SKMQDIVLGT GFLSIHPKNE
810 820 830 840 850
AEHIENGAKF PNLESINKVN GLCEDTAPSP GRVEPQKASS SADVGISKST
860 870 880 890 900
EDLSPQRSGP TGAVVKSHSI TNMETGGLKI YDILGDDGPQ PPSAAVKIAS
910 920 930 940 950
AVDGKNIVRS KSATLLYDQP LQVFTAASSS SELLSGTKAV FKFDSNHNPE
960 970 980 990 1000
EPDIIRAATV SGPQSTPHLY GPPQYNVQYS GSATVKDTLW HPKQNPQIDP
1010 1020 1030 1040 1050
VSFPPQRLPR SESAENHSYA KHSANMNFSN HNNVRANTGY HLQQRLAPAR
1060 1070 1080 1090 1100
HGEMWAISPN DRLVPAVTRT TIQRQSSVSS TASVNLGDPT RRTEGDYLSY
1110 1120 1130 1140 1150
RELHSMGRTP VMSGSQRPLS ARAYSIDGPN TSRPQSARPS INEIPERTMS
1160 1170 1180 1190 1200
VSDFNYSRTS PSKRPNTRVG SEHSLLDPPG KSKVPHDWRE QVLRHIEAKK
1210 1220 1230 1240 1250
LEKHPQTSSP GECCQDDRFM SEEQNHPSGA LSHRGLPDSL MKMPLSNGQM
1260 1270 1280 1290 1300
GQPLRPQAHY SQTHHPPQAS VARHPSREQL IDYLMLKVAH QPPYTHPHCS
1310 1320 1330 1340 1350
PRQGHELAKQ EIRVRVEKDP ELGFSISGGV GGRGNPFRPD DDGIFVTRVQ
1360 1370 1380 1390 1400
PEGPASKLLQ PGDKIIQANG YSFINIEHGQ AVSLLKTFHN AVDLIIVREV

SS
Length:1,402
Mass (Da):157,248
Last modified:July 27, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDBAFF4BD1BC48019
GO
Isoform 1 (identifier: Q80TH2-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1243-1268: Missing.

Show »
Length:1,376
Mass (Da):154,328
Checksum:i97A2B69F116DB166
GO
Isoform 2 (identifier: Q80TH2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1203-1203: K → KSMLSRSFNSNLTAVSSSHYGSSRDLHGSQGSLALSVADGRGSGGHIFR

Show »
Length:1,450
Mass (Da):162,183
Checksum:i4D8113A7636EE4DC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7ZNX6B7ZNX6_MOUSE
Erbb2ip protein
Erbin Erbb2ip
1,411Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B2RUJ2B2RUJ2_MOUSE
Erbb2ip protein
Erbin Erbb2ip
1,294Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC65755 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti255L → P in BAC65755 (PubMed:12693553).Curated1
Sequence conflicti721 – 723DKK → HAS in AAH28256 (PubMed:15489334).Curated3
Sequence conflicti908 – 910VRS → ASG in AAF77047 (PubMed:10878805).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0108081203K → KSMLSRSFNSNLTAVSSSHY GSSRDLHGSQGSLALSVADG RGSGGHIFR in isoform 2. 2 Publications1
Alternative sequenceiVSP_0108091243 – 1268Missing in isoform 1. 2 PublicationsAdd BLAST26

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK122473 mRNA Translation: BAC65755.1 Different initiation.
AC154310 Genomic DNA No translation available.
CT009728 Genomic DNA No translation available.
AK029054 mRNA Translation: BAC26267.1
AK051733 mRNA Translation: BAC34742.1
BC005691 mRNA Translation: AAH05691.3
BC028256 mRNA Translation: AAH28256.1
AF263743 mRNA Translation: AAF77047.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS26744.1 [Q80TH2-2]
CCDS79233.1 [Q80TH2-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001005868.1, NM_001005868.2 [Q80TH2-2]
NP_001276402.1, NM_001289473.1 [Q80TH2-3]
NP_001276403.1, NM_001289474.1
NP_001276404.1, NM_001289475.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000022222; ENSMUSP00000022222; ENSMUSG00000021709 [Q80TH2-1]
ENSMUST00000053927; ENSMUSP00000057956; ENSMUSG00000021709 [Q80TH2-1]
ENSMUST00000091269; ENSMUSP00000088813; ENSMUSG00000021709 [Q80TH2-3]
ENSMUST00000191275; ENSMUSP00000140536; ENSMUSG00000021709 [Q80TH2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
59079

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:59079

UCSC genome browser

More...
UCSCi
uc007rsk.3 mouse [Q80TH2-3]
uc056yux.1 mouse [Q80TH2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122473 mRNA Translation: BAC65755.1 Different initiation.
AC154310 Genomic DNA No translation available.
CT009728 Genomic DNA No translation available.
AK029054 mRNA Translation: BAC26267.1
AK051733 mRNA Translation: BAC34742.1
BC005691 mRNA Translation: AAH05691.3
BC028256 mRNA Translation: AAH28256.1
AF263743 mRNA Translation: AAF77047.1
CCDSiCCDS26744.1 [Q80TH2-2]
CCDS79233.1 [Q80TH2-3]
RefSeqiNP_001005868.1, NM_001005868.2 [Q80TH2-2]
NP_001276402.1, NM_001289473.1 [Q80TH2-3]
NP_001276403.1, NM_001289474.1
NP_001276404.1, NM_001289475.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi208523, 3 interactors
IntActiQ80TH2, 3 interactors
MINTiQ80TH2
STRINGi10090.ENSMUSP00000140536

PTM databases

iPTMnetiQ80TH2
PhosphoSitePlusiQ80TH2
SwissPalmiQ80TH2

Proteomic databases

jPOSTiQ80TH2
MaxQBiQ80TH2
PaxDbiQ80TH2
PRIDEiQ80TH2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000022222; ENSMUSP00000022222; ENSMUSG00000021709 [Q80TH2-1]
ENSMUST00000053927; ENSMUSP00000057956; ENSMUSG00000021709 [Q80TH2-1]
ENSMUST00000091269; ENSMUSP00000088813; ENSMUSG00000021709 [Q80TH2-3]
ENSMUST00000191275; ENSMUSP00000140536; ENSMUSG00000021709 [Q80TH2-2]
GeneIDi59079
KEGGimmu:59079
UCSCiuc007rsk.3 mouse [Q80TH2-3]
uc056yux.1 mouse [Q80TH2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55914
MGIiMGI:1890169 Erbin

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG410KCZ0 Eukaryota
COG4886 LUCA
GeneTreeiENSGT00940000159526
InParanoidiQ80TH2
KOiK12796
OMAiFHYGSSR
OrthoDBi100824at2759
TreeFamiTF351429

Enzyme and pathway databases

ReactomeiR-MMU-1227986 Signaling by ERBB2
R-MMU-8863795 Downregulation of ERBB2 signaling

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q80TH2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000021709 Expressed in 274 organ(s), highest expression level in submandibular gland
ExpressionAtlasiQ80TH2 baseline and differential
GenevisibleiQ80TH2 MM

Family and domain databases

Gene3Di3.80.10.10, 3 hits
InterProiView protein in InterPro
IPR032927 Erbin
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
PANTHERiPTHR23119:SF46 PTHR23119:SF46, 2 hits
PfamiView protein in Pfam
PF13855 LRR_8, 4 hits
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00369 LRR_TYP, 12 hits
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS51450 LRR, 13 hits
PS50106 PDZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiERBIN_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q80TH2
Secondary accession number(s): E9QND6
, Q8BQ14, Q8CE41, Q8K171, Q99JU3, Q9JI47
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 27, 2011
Last modified: September 18, 2019
This is version 161 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again