Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 142 (17 Jun 2020)
Sequence version 3 (16 Jun 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Kelch-like protein 13

Gene

Klhl13

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex required for mitotic progression and cytokinesis. The BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex mediates the ubiquitination of AURKB and controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Mitosis, Ubl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-8951664 Neddylation
R-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kelch-like protein 13
Alternative name(s):
BTB and kelch domain-containing protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Klhl13
Synonyms:Bklhd2, Kiaa1309
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1914705 Klhl13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001191161 – 654Kelch-like protein 13Add BLAST654

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q80TF4

PRoteomics IDEntifications database

More...
PRIDEi
Q80TF4

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q80TF4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q80TF4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000036782 Expressed in placenta and 274 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q80TF4 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex, at least composed of CUL3, KLHL9, KLHL13 and RBX1.

Interacts with AURKB (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q80TF4, 2 interactors

Molecular INTeraction database

More...
MINTi
Q80TF4

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000110972

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q80TF4 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q80TF4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini91 – 160BTBPROSITE-ProRule annotationAdd BLAST70
Domaini195 – 296BACKAdd BLAST102
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati340 – 388Kelch 1Add BLAST49
Repeati389 – 440Kelch 2Add BLAST52
Repeati441 – 487Kelch 3Add BLAST47
Repeati489 – 534Kelch 4Add BLAST46
Repeati536 – 586Kelch 5Add BLAST51
Repeati587 – 635Kelch 6Add BLAST49

Keywords - Domaini

Kelch repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4441 Eukaryota
ENOG410XNX8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154359

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_004253_14_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q80TF4

KEGG Orthology (KO)

More...
KOi
K10447

Database of Orthologous Groups

More...
OrthoDBi
250404at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q80TF4

TreeFam database of animal gene trees

More...
TreeFami
TF328485

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.120.10.80, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011705 BACK
IPR017096 BTB-kelch_protein
IPR000210 BTB/POZ_dom
IPR015915 Kelch-typ_b-propeller
IPR006652 Kelch_1
IPR011333 SKP1/BTB/POZ_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07707 BACK, 1 hit
PF00651 BTB, 1 hit
PF01344 Kelch_1, 5 hits

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF037037 Kelch-like_protein_gigaxonin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00875 BACK, 1 hit
SM00225 BTB, 1 hit
SM00612 Kelch, 6 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF117281 SSF117281, 1 hit
SSF54695 SSF54695, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50097 BTB, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q80TF4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPLKWKTSSP AIWKFPVPVL KTSRSTPLSP AYISLVEEED QHLKLCLGSE
60 70 80 90 100
MGLSSHLQSC KAGSTRIFTS NSHSSVVLQG FDQLRLDGLL CDVTLMPGDT
110 120 130 140 150
DDAYPVHRVM MASASDYFKA MFTGGMKEQE LMCIKLHGVS RVGLRKIIDF
160 170 180 190 200
IYTAKLSLNM DTLQDTLEAA SFLQILPVLD FCKVFLISGV TLDNCVEVGR
210 220 230 240 250
IANTYHLTEV DKYVNSFVLK NFAALLSTGE FLKLPFERLA FVLSSNSLKR
260 270 280 290 300
CTELDLFKAT CRWLRLEEPR MDVAAKLMKN IRFPLMTPQE LINYVQTVDF
310 320 330 340 350
MRTDNTCVNL LLEASNYQMM PFMQPVMQSD RTAIRSDTTR LVTLGGVLRQ
360 370 380 390 400
QLVVSKELRM YDEKTHEWKS LAPMDAPRYQ HGIAVIGNFL YVVGGQSNYD
410 420 430 440 450
TKGKTAVDTV FRFDPRYNKW IQVASLNEKR TFFHLSALKG FLYAVGGRNA
460 470 480 490 500
AGELPTVECY NPRTNEWTYV AKMNEPHYGH AGTVYGGVMY ISGGITHDTF
510 520 530 540 550
QKELMCFDPD TDKWTQKAPM TTVRGLHCMC TVGDRLYVIG GNHFRGTSDY
560 570 580 590 600
DDVLSCEYYS PILDQWTPIA SMLRGQSDVG VAVFENKIYV VGGYSWNNRC
610 620 630 640 650
MVEIVQKYDP EKNEWHKVFD LPESLGGIRA CTLTVYPPEE ATPSPSRESP

LSGP
Length:654
Mass (Da):73,787
Last modified:June 16, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i33E8497FEF1571D2
GO
Isoform 2 (identifier: Q80TF4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MLRFISHLYCCSSKEECSEDDKCILSR

Show »
Length:648
Mass (Da):73,255
Checksum:i16D6390BD932D6FD
GO
Isoform 3 (identifier: Q80TF4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MDILHRGELVAAILRNR

Show »
Length:638
Mass (Da):72,036
Checksum:i8F302FC2DF961AFF
GO
Isoform 4 (identifier: Q80TF4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MEGEYFFEENPFLEFLLKL

Show »
Length:640
Mass (Da):72,454
Checksum:i7678E0E4D2764598
GO
Isoform 5 (identifier: Q80TF4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.

Show »
Length:604
Mass (Da):68,165
Checksum:i084944B636C1C74B
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC65773 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0375341 – 50Missing in isoform 5. CuratedAdd BLAST50
Alternative sequenceiVSP_0375351 – 33MPLKW…SPAYI → MLRFISHLYCCSSKEECSED DKCILSR in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_0375361 – 33MPLKW…SPAYI → MDILHRGELVAAILRNR in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_0375371 – 33MPLKW…SPAYI → MEGEYFFEENPFLEFLLKL in isoform 4. CuratedAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK122491 mRNA Translation: BAC65773.1 Different initiation.
AK004677 mRNA Translation: BAB23465.1
AL773552 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS40891.1 [Q80TF4-3]
CCDS72348.1 [Q80TF4-2]
CCDS81105.1 [Q80TF4-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001277405.1, NM_001290476.2 [Q80TF4-2]
NP_001297395.1, NM_001310466.1 [Q80TF4-4]
NP_080443.1, NM_026167.4 [Q80TF4-3]
XP_011245791.1, XM_011247489.2 [Q80TF4-1]
XP_011245794.1, XM_011247492.2 [Q80TF4-3]
XP_011245795.1, XM_011247493.2 [Q80TF4-3]
XP_011245796.1, XM_011247494.2 [Q80TF4-3]
XP_017174099.1, XM_017318610.1 [Q80TF4-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000035973; ENSMUSP00000041190; ENSMUSG00000036782 [Q80TF4-3]
ENSMUST00000115313; ENSMUSP00000110968; ENSMUSG00000036782 [Q80TF4-5]
ENSMUST00000115316; ENSMUSP00000110971; ENSMUSG00000036782 [Q80TF4-4]
ENSMUST00000115317; ENSMUSP00000110972; ENSMUSG00000036782 [Q80TF4-1]
ENSMUST00000115319; ENSMUSP00000110974; ENSMUSG00000036782 [Q80TF4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
67455

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:67455

UCSC genome browser

More...
UCSCi
uc009sut.1 mouse [Q80TF4-2]
uc009suu.1 mouse [Q80TF4-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122491 mRNA Translation: BAC65773.1 Different initiation.
AK004677 mRNA Translation: BAB23465.1
AL773552 Genomic DNA No translation available.
CCDSiCCDS40891.1 [Q80TF4-3]
CCDS72348.1 [Q80TF4-2]
CCDS81105.1 [Q80TF4-4]
RefSeqiNP_001277405.1, NM_001290476.2 [Q80TF4-2]
NP_001297395.1, NM_001310466.1 [Q80TF4-4]
NP_080443.1, NM_026167.4 [Q80TF4-3]
XP_011245791.1, XM_011247489.2 [Q80TF4-1]
XP_011245794.1, XM_011247492.2 [Q80TF4-3]
XP_011245795.1, XM_011247493.2 [Q80TF4-3]
XP_011245796.1, XM_011247494.2 [Q80TF4-3]
XP_017174099.1, XM_017318610.1 [Q80TF4-3]

3D structure databases

SMRiQ80TF4
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ80TF4, 2 interactors
MINTiQ80TF4
STRINGi10090.ENSMUSP00000110972

PTM databases

iPTMnetiQ80TF4
PhosphoSitePlusiQ80TF4

Proteomic databases

PaxDbiQ80TF4
PRIDEiQ80TF4

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
29658 133 antibodies

Genome annotation databases

EnsembliENSMUST00000035973; ENSMUSP00000041190; ENSMUSG00000036782 [Q80TF4-3]
ENSMUST00000115313; ENSMUSP00000110968; ENSMUSG00000036782 [Q80TF4-5]
ENSMUST00000115316; ENSMUSP00000110971; ENSMUSG00000036782 [Q80TF4-4]
ENSMUST00000115317; ENSMUSP00000110972; ENSMUSG00000036782 [Q80TF4-1]
ENSMUST00000115319; ENSMUSP00000110974; ENSMUSG00000036782 [Q80TF4-2]
GeneIDi67455
KEGGimmu:67455
UCSCiuc009sut.1 mouse [Q80TF4-2]
uc009suu.1 mouse [Q80TF4-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
90293
MGIiMGI:1914705 Klhl13

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG4441 Eukaryota
ENOG410XNX8 LUCA
GeneTreeiENSGT00940000154359
HOGENOMiCLU_004253_14_3_1
InParanoidiQ80TF4
KOiK10447
OrthoDBi250404at2759
PhylomeDBiQ80TF4
TreeFamiTF328485

Enzyme and pathway databases

UniPathwayiUPA00143
ReactomeiR-MMU-8951664 Neddylation
R-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
67455 0 hits in 12 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Klhl13 mouse

Protein Ontology

More...
PROi
PR:Q80TF4
RNActiQ80TF4 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000036782 Expressed in placenta and 274 other tissues
GenevisibleiQ80TF4 MM

Family and domain databases

Gene3Di2.120.10.80, 1 hit
InterProiView protein in InterPro
IPR011705 BACK
IPR017096 BTB-kelch_protein
IPR000210 BTB/POZ_dom
IPR015915 Kelch-typ_b-propeller
IPR006652 Kelch_1
IPR011333 SKP1/BTB/POZ_sf
PfamiView protein in Pfam
PF07707 BACK, 1 hit
PF00651 BTB, 1 hit
PF01344 Kelch_1, 5 hits
PIRSFiPIRSF037037 Kelch-like_protein_gigaxonin, 1 hit
SMARTiView protein in SMART
SM00875 BACK, 1 hit
SM00225 BTB, 1 hit
SM00612 Kelch, 6 hits
SUPFAMiSSF117281 SSF117281, 1 hit
SSF54695 SSF54695, 1 hit
PROSITEiView protein in PROSITE
PS50097 BTB, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKLH13_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q80TF4
Secondary accession number(s): A2AL86
, A2AL87, A2AL88, A2AL89, Q9DBY7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 4, 2003
Last sequence update: June 16, 2009
Last modified: June 17, 2020
This is version 142 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again