Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Limb region 1 protein homolog

Gene

LMBR1

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Putative membrane receptor.

GO - Biological processi

Keywordsi

Molecular functionReceptor

Names & Taxonomyi

Protein namesi
Recommended name:
Limb region 1 protein homolog
Gene namesi
Name:LMBR1
Synonyms:SAPH1
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
Proteomesi
  • UP000000539 Componenti: Chromosome 2

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 18ExtracellularSequence analysisAdd BLAST18
Transmembranei19 – 39HelicalSequence analysisAdd BLAST21
Topological domaini40 – 61CytoplasmicSequence analysisAdd BLAST22
Transmembranei62 – 82HelicalSequence analysisAdd BLAST21
Topological domaini83 – 109ExtracellularSequence analysisAdd BLAST27
Transmembranei110 – 130HelicalSequence analysisAdd BLAST21
Topological domaini131 – 150CytoplasmicSequence analysisAdd BLAST20
Transmembranei151 – 171HelicalSequence analysisAdd BLAST21
Topological domaini172 – 186ExtracellularSequence analysisAdd BLAST15
Transmembranei187 – 207HelicalSequence analysisAdd BLAST21
Topological domaini208 – 295CytoplasmicSequence analysisAdd BLAST88
Transmembranei296 – 316HelicalSequence analysisAdd BLAST21
Topological domaini317 – 338ExtracellularSequence analysisAdd BLAST22
Transmembranei339 – 359HelicalSequence analysisAdd BLAST21
Topological domaini360 – 382CytoplasmicSequence analysisAdd BLAST23
Transmembranei383 – 403HelicalSequence analysisAdd BLAST21
Topological domaini404 – 425ExtracellularSequence analysisAdd BLAST22
Transmembranei426 – 446HelicalSequence analysisAdd BLAST21
Topological domaini447 – 488CytoplasmicSequence analysisAdd BLAST42

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000539081 – 488Limb region 1 protein homologAdd BLAST488

Proteomic databases

PaxDbiQ7ZUA6
PRIDEiQ7ZUA6

Expressioni

Tissue specificityi

Detected ubiquitously at low levels throughout the developing embryo. Present initially in the limb mesoderm as the limb bud emerges from the body wall and up-regulated along the posterior margin of the developing limb bud with progression of the limb outgrowth. Higher levels are detected in limb buds, otic vesicles and pharyngeal arches. Isoform 1 is detected in lung, spleen, heart, breast muscle, cartilage and liver of the adult tissues. Isoform 3 is detected in adult lung, spleen, heart and breast muscle but not detected in cartilage and liver.2 Publications

Interactioni

Protein-protein interaction databases

STRINGi9031.ENSGALP00000030628

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili246 – 286Sequence analysisAdd BLAST41

Sequence similaritiesi

Belongs to the LIMR family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3722 Eukaryota
ENOG410YKEX LUCA
GeneTreeiENSGT00390000007809
HOVERGENiHBG072983
InParanoidiQ7ZUA6
PhylomeDBiQ7ZUA6

Family and domain databases

InterProiView protein in InterPro
IPR008075 LIMR
IPR006876 LMBR1-like_membr_prot
PANTHERiPTHR12625 PTHR12625, 1 hit
PfamiView protein in Pfam
PF04791 LMBR1, 2 hits
PRINTSiPR01692 LIPOCALINIMR

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7ZUA6-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEADEVSIRE QNFHSQVREY TICFLLFAVL YIVSYFIITR YKRKADEQED
60 70 80 90 100
EDAIVNRISL FLSTFTLAVS AGAVLLLPFS IISNEILLSF PQNYYIQWLN
110 120 130 140 150
GSLIHGLWNL ASLFSNLCLF VLMPFAFFFL ESEGFAGLKK GIRARILETL
160 170 180 190 200
VMLILLALLI LGIVWVASAL IDNDAASMES LYDLWEFYLP YLYSCISLMG
210 220 230 240 250
CLLLLLCTPV GLSRMFTVMG QLLVKPTILE DLDEQMYIIT LEEEAIQRKL
260 270 280 290 300
NGISSTLENQ TVELERELEK VKCKKTNLER RKKASAWERN LVYPAVMILL
310 320 330 340 350
LIETSISVLL VAFNILYLLV DETAMPKGSG GPGIGNASLS TFGFVGAALE
360 370 380 390 400
IILIFYLMVS SVVGFYSLRF FENFIPRKDD TTMTKIIGNC VSILVLSSAL
410 420 430 440 450
PVMSRTLGIT RFDLLGDFGR FNWLGNFYIV LSYNLLFAIM TTLCLVRKFT
460 470 480
SAVREELLKA LGLDKLHLSN NPRDSETKPS ANGHQKTL
Length:488
Mass (Da):55,084
Last modified:June 1, 2003 - v1
Checksum:i7553C35EA44F0E7A
GO
Isoform 2 (identifier: Q7ZUA6-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     60-105: Missing.

Show »
Length:442
Mass (Da):49,976
Checksum:i7A48C73FBA3148D8
GO
Isoform 3 (identifier: Q7ZUA6-3) [UniParc]FASTAAdd to basket
Also known as: Lmbr1-1

The sequence of this isoform differs from the canonical sequence as follows:
     1-296: Missing.

Show »
Length:192
Mass (Da):21,153
Checksum:iD92CA578551E45AD
GO
Isoform 4 (identifier: Q7ZUA6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     279-312: ERRKKASAWERNLVYPAVMILLLIETSISVLLVA → GNMLFILPQVDCNLSDFKVLCSVCNSDLINSNCF
     313-488: Missing.

Show »
Length:312
Mass (Da):35,543
Checksum:i289272588B246FF8
GO
Isoform 5 (identifier: Q7ZUA6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-357: Missing.

Show »
Length:131
Mass (Da):14,769
Checksum:i34BE95C17D58A918
GO
Isoform 6 (identifier: Q7ZUA6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     22-30: ICFLLFAVL → GREVFRILQ
     31-488: Missing.

Show »
Length:30
Mass (Da):3,668
Checksum:i6AAEB3EE6E34D4DF
GO
Isoform 7 (identifier: Q7ZUA6-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     60-126: LFLSTFTLAV...LCLFVLMPFA → FMESCFSFFQ...RMGGFSSHRQ
     127-488: Missing.

Show »
Length:126
Mass (Da):14,695
Checksum:i043FBB0E123830DC
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti12N → I in AAP04355 (PubMed:16650944).Curated1
Sequence conflicti12N → I in ACB59247 (Ref. 6) Curated1
Sequence conflicti81I → M in AAP04355 (PubMed:16650944).Curated1
Sequence conflicti411R → Q in BAB61999 (Ref. 7) Curated1
Sequence conflicti487T → A in AAP04355 (PubMed:16650944).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti266R → Q in Lmbr1-N; associated with preaxial polydactyly. 2 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0412001 – 357Missing in isoform 5. 1 PublicationAdd BLAST357
Alternative sequenceiVSP_0412011 – 296Missing in isoform 3. 1 PublicationAdd BLAST296
Alternative sequenceiVSP_04120222 – 30ICFLLFAVL → GREVFRILQ in isoform 6. 1 Publication9
Alternative sequenceiVSP_04120331 – 488Missing in isoform 6. 1 PublicationAdd BLAST458
Alternative sequenceiVSP_04120460 – 126LFLST…LMPFA → FMESCFSFFQFMFVCVDALC LFLLGVGRICWLKKGDQSTH SGDPCNAHTSCTAYPWNRMG GFSSHRQ in isoform 7. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_02649260 – 105Missing in isoform 2. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_041205127 – 488Missing in isoform 7. 1 PublicationAdd BLAST362
Alternative sequenceiVSP_041206279 – 312ERRKK…VLLVA → GNMLFILPQVDCNLSDFKVL CSVCNSDLINSNCF in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_041207313 – 488Missing in isoform 4. 1 PublicationAdd BLAST176

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY316689 mRNA Translation: AAQ83702.1
AY251537 mRNA Translation: AAP04355.2
EF682500 mRNA Translation: ABU82889.1
AB105057 mRNA Translation: BAC65224.1
EF682501 mRNA Translation: ABU82890.1
EF682502 mRNA Translation: ABU82891.1
EF682503 mRNA Translation: ABU82892.1
EU551669 mRNA Translation: ACB59247.1
AB053322 mRNA Translation: BAB61999.1
RefSeqiNP_989503.1, NM_204172.1 [Q7ZUA6-1]
UniGeneiGga.1918
Gga.50858

Genome annotation databases

EnsembliENSGALT00000071478; ENSGALP00000048492; ENSGALG00000030379 [Q7ZUA6-1]
ENSGALT00000087661; ENSGALP00000063963; ENSGALG00000030379 [Q7ZUA6-7]
GeneIDi373986
KEGGigga:373986

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiLMBR1_CHICK
AccessioniPrimary (citable) accession number: Q7ZUA6
Secondary accession number(s): B2CW63
, E0W5S4, E0W5S5, E0W5S6, E0W5S7, Q7ZZZ1, Q90WF5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: June 1, 2003
Last modified: May 23, 2018
This is version 68 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health