Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Limb region 1 protein homolog

Gene

LMBR1

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Putative membrane receptor.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Limb region 1 protein homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LMBR1
Synonyms:SAPH1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiGallus gallus (Chicken)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9031 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000539 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 18ExtracellularSequence analysisAdd BLAST18
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei19 – 39HelicalSequence analysisAdd BLAST21
Topological domaini40 – 61CytoplasmicSequence analysisAdd BLAST22
Transmembranei62 – 82HelicalSequence analysisAdd BLAST21
Topological domaini83 – 109ExtracellularSequence analysisAdd BLAST27
Transmembranei110 – 130HelicalSequence analysisAdd BLAST21
Topological domaini131 – 150CytoplasmicSequence analysisAdd BLAST20
Transmembranei151 – 171HelicalSequence analysisAdd BLAST21
Topological domaini172 – 186ExtracellularSequence analysisAdd BLAST15
Transmembranei187 – 207HelicalSequence analysisAdd BLAST21
Topological domaini208 – 295CytoplasmicSequence analysisAdd BLAST88
Transmembranei296 – 316HelicalSequence analysisAdd BLAST21
Topological domaini317 – 338ExtracellularSequence analysisAdd BLAST22
Transmembranei339 – 359HelicalSequence analysisAdd BLAST21
Topological domaini360 – 382CytoplasmicSequence analysisAdd BLAST23
Transmembranei383 – 403HelicalSequence analysisAdd BLAST21
Topological domaini404 – 425ExtracellularSequence analysisAdd BLAST22
Transmembranei426 – 446HelicalSequence analysisAdd BLAST21
Topological domaini447 – 488CytoplasmicSequence analysisAdd BLAST42

Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000539081 – 488Limb region 1 protein homologAdd BLAST488

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7ZUA6

PRoteomics IDEntifications database

More...
PRIDEi
Q7ZUA6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected ubiquitously at low levels throughout the developing embryo. Present initially in the limb mesoderm as the limb bud emerges from the body wall and up-regulated along the posterior margin of the developing limb bud with progression of the limb outgrowth. Higher levels are detected in limb buds, otic vesicles and pharyngeal arches. Isoform 1 is detected in lung, spleen, heart, breast muscle, cartilage and liver of the adult tissues. Isoform 3 is detected in adult lung, spleen, heart and breast muscle but not detected in cartilage and liver.2 Publications

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7ZUA6 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9031.ENSGALP00000030628

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili246 – 286Sequence analysisAdd BLAST41

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the LIMR family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3722 Eukaryota
ENOG410YKEX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007809

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG072983

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7ZUA6

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7ZUA6

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008075 LIMR
IPR006876 LMBR1-like_membr_prot

The PANTHER Classification System

More...
PANTHERi
PTHR12625 PTHR12625, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04791 LMBR1, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01692 LIPOCALINIMR

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7ZUA6-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEADEVSIRE QNFHSQVREY TICFLLFAVL YIVSYFIITR YKRKADEQED
60 70 80 90 100
EDAIVNRISL FLSTFTLAVS AGAVLLLPFS IISNEILLSF PQNYYIQWLN
110 120 130 140 150
GSLIHGLWNL ASLFSNLCLF VLMPFAFFFL ESEGFAGLKK GIRARILETL
160 170 180 190 200
VMLILLALLI LGIVWVASAL IDNDAASMES LYDLWEFYLP YLYSCISLMG
210 220 230 240 250
CLLLLLCTPV GLSRMFTVMG QLLVKPTILE DLDEQMYIIT LEEEAIQRKL
260 270 280 290 300
NGISSTLENQ TVELERELEK VKCKKTNLER RKKASAWERN LVYPAVMILL
310 320 330 340 350
LIETSISVLL VAFNILYLLV DETAMPKGSG GPGIGNASLS TFGFVGAALE
360 370 380 390 400
IILIFYLMVS SVVGFYSLRF FENFIPRKDD TTMTKIIGNC VSILVLSSAL
410 420 430 440 450
PVMSRTLGIT RFDLLGDFGR FNWLGNFYIV LSYNLLFAIM TTLCLVRKFT
460 470 480
SAVREELLKA LGLDKLHLSN NPRDSETKPS ANGHQKTL
Length:488
Mass (Da):55,084
Last modified:June 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7553C35EA44F0E7A
GO
Isoform 2 (identifier: Q7ZUA6-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     60-105: Missing.

Show »
Length:442
Mass (Da):49,976
Checksum:i7A48C73FBA3148D8
GO
Isoform 3 (identifier: Q7ZUA6-3) [UniParc]FASTAAdd to basket
Also known as: Lmbr1-1

The sequence of this isoform differs from the canonical sequence as follows:
     1-296: Missing.

Show »
Length:192
Mass (Da):21,153
Checksum:iD92CA578551E45AD
GO
Isoform 4 (identifier: Q7ZUA6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     279-312: ERRKKASAWERNLVYPAVMILLLIETSISVLLVA → GNMLFILPQVDCNLSDFKVLCSVCNSDLINSNCF
     313-488: Missing.

Show »
Length:312
Mass (Da):35,543
Checksum:i289272588B246FF8
GO
Isoform 5 (identifier: Q7ZUA6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-357: Missing.

Show »
Length:131
Mass (Da):14,769
Checksum:i34BE95C17D58A918
GO
Isoform 6 (identifier: Q7ZUA6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     22-30: ICFLLFAVL → GREVFRILQ
     31-488: Missing.

Show »
Length:30
Mass (Da):3,668
Checksum:i6AAEB3EE6E34D4DF
GO
Isoform 7 (identifier: Q7ZUA6-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     60-126: LFLSTFTLAV...LCLFVLMPFA → FMESCFSFFQ...RMGGFSSHRQ
     127-488: Missing.

Show »
Length:126
Mass (Da):14,695
Checksum:i043FBB0E123830DC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1L1RSR0A0A1L1RSR0_CHICK
Limb region 1 protein homolog
LMBR1
30Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti12N → I in AAP04355 (PubMed:16650944).Curated1
Sequence conflicti12N → I in ACB59247 (Ref. 6) Curated1
Sequence conflicti81I → M in AAP04355 (PubMed:16650944).Curated1
Sequence conflicti411R → Q in BAB61999 (Ref. 7) Curated1
Sequence conflicti487T → A in AAP04355 (PubMed:16650944).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti266R → Q in Lmbr1-N; associated with preaxial polydactyly. 2 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0412001 – 357Missing in isoform 5. 1 PublicationAdd BLAST357
Alternative sequenceiVSP_0412011 – 296Missing in isoform 3. 1 PublicationAdd BLAST296
Alternative sequenceiVSP_04120222 – 30ICFLLFAVL → GREVFRILQ in isoform 6. 1 Publication9
Alternative sequenceiVSP_04120331 – 488Missing in isoform 6. 1 PublicationAdd BLAST458
Alternative sequenceiVSP_04120460 – 126LFLST…LMPFA → FMESCFSFFQFMFVCVDALC LFLLGVGRICWLKKGDQSTH SGDPCNAHTSCTAYPWNRMG GFSSHRQ in isoform 7. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_02649260 – 105Missing in isoform 2. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_041205127 – 488Missing in isoform 7. 1 PublicationAdd BLAST362
Alternative sequenceiVSP_041206279 – 312ERRKK…VLLVA → GNMLFILPQVDCNLSDFKVL CSVCNSDLINSNCF in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_041207313 – 488Missing in isoform 4. 1 PublicationAdd BLAST176

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY316689 mRNA Translation: AAQ83702.1
AY251537 mRNA Translation: AAP04355.2
EF682500 mRNA Translation: ABU82889.1
AB105057 mRNA Translation: BAC65224.1
EF682501 mRNA Translation: ABU82890.1
EF682502 mRNA Translation: ABU82891.1
EF682503 mRNA Translation: ABU82892.1
EU551669 mRNA Translation: ACB59247.1
AB053322 mRNA Translation: BAB61999.1

NCBI Reference Sequences

More...
RefSeqi
NP_989503.1, NM_204172.1 [Q7ZUA6-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Gga.1918
Gga.50858

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSGALT00000071478; ENSGALP00000048492; ENSGALG00000030379 [Q7ZUA6-1]
ENSGALT00000087661; ENSGALP00000063963; ENSGALG00000030379 [Q7ZUA6-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
373986

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
gga:373986

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY316689 mRNA Translation: AAQ83702.1
AY251537 mRNA Translation: AAP04355.2
EF682500 mRNA Translation: ABU82889.1
AB105057 mRNA Translation: BAC65224.1
EF682501 mRNA Translation: ABU82890.1
EF682502 mRNA Translation: ABU82891.1
EF682503 mRNA Translation: ABU82892.1
EU551669 mRNA Translation: ACB59247.1
AB053322 mRNA Translation: BAB61999.1
RefSeqiNP_989503.1, NM_204172.1 [Q7ZUA6-1]
UniGeneiGga.1918
Gga.50858

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Protein-protein interaction databases

STRINGi9031.ENSGALP00000030628

Proteomic databases

PaxDbiQ7ZUA6
PRIDEiQ7ZUA6

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSGALT00000071478; ENSGALP00000048492; ENSGALG00000030379 [Q7ZUA6-1]
ENSGALT00000087661; ENSGALP00000063963; ENSGALG00000030379 [Q7ZUA6-7]
GeneIDi373986
KEGGigga:373986

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
64327

Phylogenomic databases

eggNOGiKOG3722 Eukaryota
ENOG410YKEX LUCA
GeneTreeiENSGT00390000007809
HOVERGENiHBG072983
InParanoidiQ7ZUA6
PhylomeDBiQ7ZUA6

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q7ZUA6

Gene expression databases

ExpressionAtlasiQ7ZUA6 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR008075 LIMR
IPR006876 LMBR1-like_membr_prot
PANTHERiPTHR12625 PTHR12625, 1 hit
PfamiView protein in Pfam
PF04791 LMBR1, 2 hits
PRINTSiPR01692 LIPOCALINIMR

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLMBR1_CHICK
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7ZUA6
Secondary accession number(s): B2CW63
, E0W5S4, E0W5S5, E0W5S6, E0W5S7, Q7ZZZ1, Q90WF5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: June 1, 2003
Last modified: October 10, 2018
This is version 69 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again