Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UPF0461 protein C5orf24

Gene

C5orf24

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
UPF0461 protein C5orf24
Gene namesi
Name:C5orf24
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000181904.8
HGNCiHGNC:26746 C5orf24
neXtProtiNX_Q7Z6I8

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000181904
PharmGKBiPA144596505

Polymorphism and mutation databases

BioMutaiC5orf24
DMDMi74738816

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002957081 – 188UPF0461 protein C5orf24Add BLAST188

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei37PhosphoserineCombined sources1
Cross-linki75Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei121PhosphoserineCombined sources1
Modified residuei180PhosphoserineCombined sources1
Cross-linki184Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ7Z6I8
MaxQBiQ7Z6I8
PaxDbiQ7Z6I8
PeptideAtlasiQ7Z6I8
PRIDEiQ7Z6I8
ProteomicsDBi69415
69416 [Q7Z6I8-2]

PTM databases

iPTMnetiQ7Z6I8
PhosphoSitePlusiQ7Z6I8

Expressioni

Gene expression databases

BgeeiENSG00000181904
ExpressionAtlasiQ7Z6I8 baseline and differential
GenevisibleiQ7Z6I8 HS

Organism-specific databases

HPAiHPA057749
HPA062502

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
EFEMP2O959673EBI-9995695,EBI-743414

Protein-protein interaction databases

BioGridi126409, 24 interactors
IntActiQ7Z6I8, 11 interactors
MINTiQ7Z6I8
STRINGi9606.ENSP00000337044

Structurei

3D structure databases

ProteinModelPortaliQ7Z6I8
SMRiQ7Z6I8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the UPF0461 family.Curated

Phylogenomic databases

eggNOGiENOG410IFPQ Eukaryota
ENOG4111J4R LUCA
GeneTreeiENSGT00390000014889
HOGENOMiHOG000111510
HOVERGENiHBG097615
InParanoidiQ7Z6I8
OMAiHKPIACQ
OrthoDBiEOG091G0P84
PhylomeDBiQ7Z6I8
TreeFamiTF333072

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z6I8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMHPVASSNP AFCGPGKPSC LNEDAMRAAD QFDIYSSQQS KYSHTVNHKP
60 70 80 90 100
MVCQRQDPLN ETHLQTTSGR SIEIKDELKK KKNLNRSGKR GRPSGTTKSA
110 120 130 140 150
GYRTSTGRPL GTTKAAGFKT SPGRPLGTTK AAGYKVSPGR PPGSIKALSR
160 170 180
LADLGYGCGT AAFPYPMMHG RAVHGVEETS SEVKPPNE
Length:188
Mass (Da):20,132
Last modified:October 1, 2003 - v1
Checksum:iBB335B61BD2B7DC8
GO
Isoform 2 (identifier: Q7Z6I8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-188: SIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE → KKQQAFRCSSDA

Show »
Length:155
Mass (Da):16,725
Checksum:i7A38CB24BCCC3E6B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti161A → V in BAC04448 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027011144 – 188SIKAL…KPPNE → KKQQAFRCSSDA in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ437658 mRNA Translation: CAD26900.2
AK094881 mRNA Translation: BAC04448.1
CH471062 Genomic DNA Translation: EAW62234.1
CH471062 Genomic DNA Translation: EAW62235.1
CH471062 Genomic DNA Translation: EAW62236.1
BC053677 mRNA Translation: AAH53677.1
CCDSiCCDS4179.1 [Q7Z6I8-1]
CCDS75307.1 [Q7Z6I8-2]
RefSeqiNP_001129058.1, NM_001135586.1 [Q7Z6I8-1]
NP_001287823.1, NM_001300894.1 [Q7Z6I8-2]
NP_689622.2, NM_152409.3 [Q7Z6I8-1]
XP_005271946.1, XM_005271889.3 [Q7Z6I8-1]
XP_016864538.1, XM_017009049.1 [Q7Z6I8-1]
XP_016864539.1, XM_017009050.1 [Q7Z6I8-1]
UniGeneiHs.708536

Genome annotation databases

EnsembliENST00000338051; ENSP00000337044; ENSG00000181904 [Q7Z6I8-1]
ENST00000394976; ENSP00000378427; ENSG00000181904 [Q7Z6I8-1]
ENST00000435259; ENSP00000395764; ENSG00000181904 [Q7Z6I8-1]
ENST00000504727; ENSP00000421647; ENSG00000181904 [Q7Z6I8-2]
GeneIDi134553
KEGGihsa:134553
UCSCiuc003kzx.4 human [Q7Z6I8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCE024_HUMAN
AccessioniPrimary (citable) accession number: Q7Z6I8
Secondary accession number(s): D3DQA7, Q86Y53, Q8N1T9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: October 1, 2003
Last modified: June 20, 2018
This is version 109 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health