Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 142 (16 Oct 2019)
Sequence version 2 (03 May 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ankyrin repeat and sterile alpha motif domain-containing protein 1B

Gene

ANKS1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform 2 may participate in the regulation of nucleoplasmic coilin protein interactions in neuronal and transformed cells.
Isoform 3 can regulate global protein synthesis by altering nucleolar numbers.By similarity2 Publications
Isoform 4 may play a role as a modulator of APP processing. Overexpression can down-regulate APP processing.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ephrin receptor binding Source: UniProtKB

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Alternative name(s):
Amyloid-beta protein intracellular domain-associated protein 1
Short name:
AIDA-1
E2A-PBX1-associated protein
Short name:
EB-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ANKS1B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24600 ANKS1B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607815 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7Z6G8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Nucleus, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
56899

Open Targets

More...
OpenTargetsi
ENSG00000185046

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA128394692

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q7Z6G8

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ANKS1B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
332278155

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003272591 – 1248Ankyrin repeat and sterile alpha motif domain-containing protein 1BAdd BLAST1248

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei309PhosphoserineBy similarity1
Modified residuei310PhosphoserineBy similarity1
Modified residuei314PhosphoserineBy similarity1
Modified residuei353PhosphoserineBy similarity1
Modified residuei364PhosphoserineBy similarity1
Modified residuei503PhosphothreonineBy similarity1
Modified residuei507PhosphoserineBy similarity1
Modified residuei510PhosphoserineBy similarity1
Modified residuei738PhosphoserineBy similarity1
Modified residuei773PhosphothreonineBy similarity1
Modified residuei775PhosphoserineBy similarity1
Modified residuei901PhosphotyrosineBy similarity1
Modified residuei974PhosphoserineBy similarity1
Modified residuei1007PhosphotyrosineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform 3 nuclear translocation requires an NMDAR-dependent proteolytic cleavage.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7Z6G8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q7Z6G8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q7Z6G8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q7Z6G8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7Z6G8

PeptideAtlas

More...
PeptideAtlasi
Q7Z6G8

PRoteomics IDEntifications database

More...
PRIDEi
Q7Z6G8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
28297
29375
31007
69401 [Q7Z6G8-1]
69402 [Q7Z6G8-2]
69403 [Q7Z6G8-3]
69404 [Q7Z6G8-4]
69405 [Q7Z6G8-5]
69406 [Q7Z6G8-6]
69407 [Q7Z6G8-7]
69408 [Q7Z6G8-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7Z6G8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7Z6G8

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q7Z6G8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in marrow from patients with pre-B ALL associated with the t(1;19) translocation. Strongly expressed in brain and testis. Expressed in fetal brain. Isoform 4 is highly expressed in brain (at protein level). Isoform 6 is expressed in brain and several cancer cell lines.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Transcriptionally up-regulated in t(1:19) pre-B cell acute lymphocytic leukemia by the chimeric TCF3-PBX1. Not expressed in pre-B cell that lack this translocation.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000185046 Expressed in 154 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7Z6G8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7Z6G8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA044628

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Isoform 3 interacts with DLG4 (By similarity).

Interacts with EPHA8.

Isoform 2 interacts with COIL.

Isoform 4 interacts with APP and EPHA8.

Isoform 6 interacts with EPHA8.

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
COILP384323EBI-20771303,EBI-945751

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121229, 10 interactors

Database of interacting proteins

More...
DIPi
DIP-41406N

Protein interaction database and analysis system

More...
IntActi
Q7Z6G8, 11 interactors

Molecular INTeraction database

More...
MINTi
Q7Z6G8

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000449629

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11248
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7Z6G8

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q7Z6G8

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati2 – 31ANK 1Add BLAST30
Repeati58 – 87ANK 2Add BLAST30
Repeati91 – 120ANK 3Add BLAST30
Repeati127 – 156ANK 4Add BLAST30
Repeati160 – 189ANK 5Add BLAST30
Repeati193 – 222ANK 6Add BLAST30
Repeati225 – 254ANK 7Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini810 – 876SAM 1PROSITE-ProRule annotationAdd BLAST67
Domaini884 – 949SAM 2PROSITE-ProRule annotationAdd BLAST66
Domaini1056 – 1213PIDPROSITE-ProRule annotationAdd BLAST158

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi935 – 938Nuclear localization signal1 Publication4

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0507 Eukaryota
COG0666 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154572

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007214

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7Z6G8

KEGG Orthology (KO)

More...
KOi
K21413

Identification of Orthologs from Complete Genome Data

More...
OMAi
QQEDNDP

Database of Orthologous Groups

More...
OrthoDBi
549581at2759

TreeFam database of animal gene trees

More...
TreeFami
TF320582

Family and domain databases

Conserved Domains Database

More...
CDDi
cd09499 SAM_AIDA1AB-like_repeat1, 1 hit
cd09500 SAM_AIDA1AB-like_repeat2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.150.50, 2 hits
1.25.40.20, 2 hits
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033636 ANKS1B
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
IPR001660 SAM
IPR013761 SAM/pointed_sf
IPR041880 SAM_ANKS1_repeat1
IPR041882 SAM_ANKS1_repeat2

The PANTHER Classification System

More...
PANTHERi
PTHR24174:SF3 PTHR24174:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 3 hits
PF00640 PID, 1 hit
PF00536 SAM_1, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01415 ANKYRIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 6 hits
SM00462 PTB, 1 hit
SM00454 SAM, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47769 SSF47769, 2 hits
SSF48403 SSF48403, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 5 hits
PS01179 PID, 1 hit
PS50105 SAM_DOMAIN, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 10 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z6G8-1) [UniParc]FASTAAdd to basket
Also known as: AIDA-1b

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGKDQELLEA ARTGNVALVE KLLSGRKGGI LGGGSGPLPL SNLLSIWRGP
60 70 80 90 100
NVNCTDSSGY TALHHAALNG HKDIVLKLLQ YEASTNVADN KGYFPIHLAA
110 120 130 140 150
WKGDVEIVKI LIHHGPSHSR VNEQNNENET ALHCAAQYGH SEVVAVLLEE
160 170 180 190 200
LTDPTIRNSK LETPLDLAAL YGRLRVVKMI ISAHPNLMSC NTRKHTPLHL
210 220 230 240 250
AARNGHKAVV QVLLEAGMDV SCQTEKGSAL HEAALFGKVD VVRVLLETGI
260 270 280 290 300
DANIKDSLGR TVLDILKEHP SQKSLQIATL LQEYLEGVGR STVLEEPVQE
310 320 330 340 350
DATQETHISS PVESPSQKTK SETVTGELSK LLDEIKLCQE KDYSFEDLCH
360 370 380 390 400
TISDHYLDNL SKISEEELGK NGSQSVRTSS TINLSPGEVE EEDDDENTCG
410 420 430 440 450
PSGLWEALTP CNGCRNLGFP MLAQESYPKK RNYTMEIVPS ASLDTFPSEN
460 470 480 490 500
ENFLCDLMDT AVTKKPCSLE IARAPSPRTD NASEVAVTTP GTSNHRNSST
510 520 530 540 550
GPTPDCSPPS PDTALKNIVK VIRPQPKQRT SIVSSLDFHR MNHNQEYFEI
560 570 580 590 600
NTSTGCTSFT ASPPASPPTS SVGTTEVKNE GTNHTDDLSR QDDNDPPKEY
610 620 630 640 650
DPGQFAGLLH GSSPACESPE NPFHLYGKRE QCEKGQDEVS LANSPLPFKQ
660 670 680 690 700
SPIENNSEPL VKKIKPKVVS RTIFHKKSNQ LENHTIVGTR STRSGSRNGD
710 720 730 740 750
QWVMNAGGFV ERACTLGRIR SLPKALIDMH LSKSVSKSDS DLIAYPSNEK
760 770 780 790 800
TSRVNWSESS TAEHSSKGNS ERTPSFTSEW EEIDKIMSSI DVGINNELKE
810 820 830 840 850
MNGETTRPRC PVQTVGQWLE SIGLPQYENH LMANGFDNVQ FMGSNVMEDQ
860 870 880 890 900
DLLEIGILNS GHRQRILQAI QLLPKMRPIG HDGYHPTSVA EWLDSIELGD
910 920 930 940 950
YTKAFLINGY TSMDLLKKIW EVELINVLKI NLIGHRKRIL ASLGDRLHDD
960 970 980 990 1000
PPQKPPRSIT LREPSGNHTP PQLSPSLSQS TYTTGGSLDV PHIIMQGDAR
1010 1020 1030 1040 1050
RRRNENYFDD IPRSKLERQM AQTGDWGEPS ITLRPPNEAT ASTPVQYWQH
1060 1070 1080 1090 1100
HPEKLIFQSC DYKAFYLGSM LIKELRGTES TQDACAKMRA NCQKSTEQMK
1110 1120 1130 1140 1150
KVPTIILSVS YKGVKFIDAT NKNIIAEHEI RNISCAAQDP EDLSTFAYIT
1160 1170 1180 1190 1200
KDLKSNHHYC HVFTAFDVNL AYEIILTLGQ AFEVAYQLAL QARKGGHSST
1210 1220 1230 1240
LPESFENKPS KPIPKPRVSI RKSVDLLHAS HTGQEPSERH TEEALRKF
Length:1,248
Mass (Da):138,066
Last modified:May 3, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEC3921C45083426D
GO
Isoform 2 (identifier: Q7Z6G8-2) [UniParc]FASTAAdd to basket
Also known as: AIDA-1c

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     963-1022: Missing.
     1225-1248: DLLHASHTGQEPSERHTEEALRKF → QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

Show »
Length:426
Mass (Da):48,432
Checksum:i0AE12663DD16CAC2
GO
Isoform 3 (identifier: Q7Z6G8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     1022-1022: Q → QSSVCEIWTNQNAGFPFSAIHQVHN
     1225-1248: DLLHASHTGQEPSERHTEEALRKF → QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

Show »
Length:510
Mass (Da):57,865
Checksum:i882DB0117D894E54
GO
Isoform 4 (identifier: Q7Z6G8-4) [UniParc]FASTAAdd to basket
Also known as: AIDA-1a

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     1225-1248: DLLHASHTGQEPSERHTEEALRKF → PFCFKADRPI

Show »
Length:460
Mass (Da):52,273
Checksum:i34A6DD31C86685CD
GO
Isoform 5 (identifier: Q7Z6G8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     963-1022: EPSGNHTPPQ...RSKLERQMAQ → SSVCEIWTNQNAGFPFSAIHQVHN
     1225-1248: DLLHASHTGQEPSERHTEEALRKF → QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

Show »
Length:450
Mass (Da):51,100
Checksum:i7513E87841E4A57C
GO
Isoform 6 (identifier: Q7Z6G8-6) [UniParc]FASTAAdd to basket
Also known as: AIDA-1bDeltaAnk

The sequence of this isoform differs from the canonical sequence as follows:
     1-420: Missing.
     804-807: Missing.
     963-1022: Missing.

Show »
Length:764
Mass (Da):85,202
Checksum:i7C107E6688522EF0
GO
Isoform 7 (identifier: Q7Z6G8-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     963-1022: Missing.

Show »
Length:414
Mass (Da):47,104
Checksum:iAD92EB5F8954E011
GO
Isoform 8 (identifier: Q7Z6G8-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-831: Missing.
     927-1022: VLKINLIGHR...RSKLERQMAQ → QSSVCEIWTNQNAGFPFSAIHQVHN
     1225-1247: DLLHASHTGQEPSERHTEEALRK → IDPSEQKTLANLPWIVEPGQEAKRGINTKYETTI

Show »
Length:357
Mass (Da):40,277
Checksum:i07892A522BFC2835
GO
Isoform 9 (identifier: Q7Z6G8-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-994: Missing.

Note: No experimental confirmation available.
Show »
Length:254
Mass (Da):28,943
Checksum:i33299F04446DCF7F
GO
Isoform 10 (identifier: Q7Z6G8-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3-807: Missing.
     963-1022: Missing.
     1225-1247: DLLHASHTGQEPSERHTEEALRK → IDPSEQKTLANLPWIVEPGQEAKRGINTKYETTI

Note: No experimental confirmation available.
Show »
Length:394
Mass (Da):44,522
Checksum:iD921575BBFF3C4C6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QSU0J3QSU0_HUMAN
Ankyrin repeat and sterile alpha mo...
ANKS1B
332Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VVQ4F8VVQ4_HUMAN
Ankyrin repeat and sterile alpha mo...
ANKS1B
562Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YI72H0YI72_HUMAN
Ankyrin repeat and sterile alpha mo...
ANKS1B
532Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GMN5R4GMN5_HUMAN
Ankyrin repeat and sterile alpha mo...
ANKS1B
107Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GMS8R4GMS8_HUMAN
Ankyrin repeat and sterile alpha mo...
ANKS1B
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJZ1H0YJZ1_HUMAN
Ankyrin repeat and sterile alpha mo...
ANKS1B
52Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GN07R4GN07_HUMAN
Ankyrin repeat and sterile alpha mo...
ANKS1B
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VR14F8VR14_HUMAN
Ankyrin repeat and sterile alpha mo...
ANKS1B
289Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GN73R4GN73_HUMAN
Ankyrin repeat and sterile alpha mo...
ANKS1B
27Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GMQ4R4GMQ4_HUMAN
Ankyrin repeat and sterile alpha mo...
ANKS1B
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAP38184 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti290 – 291RS → KYA in AAP37612 (PubMed:15004329).Curated2
Sequence conflicti813Q → L in BAF82457 (PubMed:14702039).Curated1
Sequence conflicti854E → G in AAI42670 (PubMed:15489334).Curated1
Sequence conflicti1160C → R in BAG57507 (PubMed:14702039).Curated1
Sequence conflicti1167D → G in BAG58059 (PubMed:14702039).Curated1
Isoform 8 (identifier: Q7Z6G8-8)
Sequence conflicti325P → R in AAH68451 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0464141 – 994Missing in isoform 9. 1 PublicationAdd BLAST994
Alternative sequenceiVSP_0327011 – 831Missing in isoform 8. 1 PublicationAdd BLAST831
Alternative sequenceiVSP_0327021 – 774Missing in isoform 3, isoform 4, isoform 5, isoform 2 and isoform 7. 5 PublicationsAdd BLAST774
Alternative sequenceiVSP_0327031 – 420Missing in isoform 6. 1 PublicationAdd BLAST420
Alternative sequenceiVSP_0464153 – 807Missing in isoform 10. 1 PublicationAdd BLAST805
Alternative sequenceiVSP_032704775 – 807SFTSE…GETTR → MMWQCHLSAQDYRYYPVDGY SLLKRFPLHPLTG in isoform 3, isoform 4, isoform 5, isoform 2 and isoform 7. 5 PublicationsAdd BLAST33
Alternative sequenceiVSP_032705804 – 807Missing in isoform 6. 1 Publication4
Alternative sequenceiVSP_032706927 – 1022VLKIN…RQMAQ → QSSVCEIWTNQNAGFPFSAI HQVHN in isoform 8. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_032707963 – 1022Missing in isoform 2, isoform 6, isoform 7 and isoform 10. 5 PublicationsAdd BLAST60
Alternative sequenceiVSP_032708963 – 1022EPSGN…RQMAQ → SSVCEIWTNQNAGFPFSAIH QVHN in isoform 5. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_0327091022Q → QSSVCEIWTNQNAGFPFSAI HQVHN in isoform 3. 2 Publications1
Alternative sequenceiVSP_0327101225 – 1248DLLHA…ALRKF → QIDPSEQKTLANLPWIVEPG QEAKRGINTKYETTIF in isoform 3, isoform 5 and isoform 2. 3 PublicationsAdd BLAST24
Alternative sequenceiVSP_0327111225 – 1248DLLHA…ALRKF → PFCFKADRPI in isoform 4. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_0327121225 – 1247DLLHA…EALRK → IDPSEQKTLANLPWIVEPGQ EAKRGINTKYETTI in isoform 8 and isoform 10. 2 PublicationsAdd BLAST23

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY281131 mRNA Translation: AAP37612.1
AY281132 mRNA Translation: AAP37613.1
AY283057 mRNA Translation: AAP38184.2 Different initiation.
AY753193 mRNA Translation: AAV28691.1
AF164792 mRNA Translation: AAF80756.1
AK289768 mRNA Translation: BAF82457.1
AK294191 mRNA Translation: BAG57507.1
AK294994 mRNA Translation: BAG58059.1
AC008126 Genomic DNA No translation available.
AC011248 Genomic DNA No translation available.
AC021653 Genomic DNA No translation available.
AC048330 Genomic DNA No translation available.
AC069437 Genomic DNA No translation available.
AC078916 Genomic DNA No translation available.
AC079954 Genomic DNA No translation available.
AC084374 Genomic DNA No translation available.
AC117377 Genomic DNA No translation available.
AC126616 Genomic DNA No translation available.
AC141554 Genomic DNA No translation available.
AC141555 Genomic DNA No translation available.
AC141556 Genomic DNA No translation available.
BC026313 mRNA Translation: AAH26313.2
BC068451 mRNA Translation: AAH68451.1
BC142669 mRNA Translation: AAI42670.1
BC150204 mRNA Translation: AAI50205.1
AF145204 mRNA Translation: AAD33951.1
AY620824 mRNA Translation: AAT39519.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55864.1 [Q7Z6G8-9]
CCDS55865.1 [Q7Z6G8-8]
CCDS55866.1 [Q7Z6G8-7]
CCDS55867.1 [Q7Z6G8-2]
CCDS55868.1 [Q7Z6G8-5]
CCDS55869.1 [Q7Z6G8-4]
CCDS55870.1 [Q7Z6G8-3]
CCDS55871.1 [Q7Z6G8-10]
CCDS55872.1 [Q7Z6G8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001190994.1, NM_001204065.1
NP_001190995.1, NM_001204066.1 [Q7Z6G8-8]
NP_001190996.1, NM_001204067.1 [Q7Z6G8-10]
NP_001190997.1, NM_001204068.1 [Q7Z6G8-4]
NP_001190998.1, NM_001204069.1 [Q7Z6G8-5]
NP_001190999.1, NM_001204070.1 [Q7Z6G8-2]
NP_001191008.1, NM_001204079.1
NP_001191009.1, NM_001204080.1
NP_001191010.1, NM_001204081.1 [Q7Z6G8-9]
NP_064525.1, NM_020140.3 [Q7Z6G8-7]
NP_690001.3, NM_152788.4 [Q7Z6G8-1]
NP_858056.2, NM_181670.3 [Q7Z6G8-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000341752; ENSP00000345510; ENSG00000185046 [Q7Z6G8-9]
ENST00000546568; ENSP00000448205; ENSG00000185046 [Q7Z6G8-2]
ENST00000546960; ENSP00000447839; ENSG00000185046 [Q7Z6G8-4]
ENST00000547010; ENSP00000448512; ENSG00000185046 [Q7Z6G8-6]
ENST00000547446; ENSP00000450015; ENSG00000185046 [Q7Z6G8-10]
ENST00000547776; ENSP00000449629; ENSG00000185046 [Q7Z6G8-1]
ENST00000549025; ENSP00000447312; ENSG00000185046 [Q7Z6G8-8]
ENST00000549493; ENSP00000448203; ENSG00000185046 [Q7Z6G8-3]
ENST00000549558; ENSP00000448993; ENSG00000185046 [Q7Z6G8-7]
ENST00000550693; ENSP00000447999; ENSG00000185046 [Q7Z6G8-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56899

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:56899

UCSC genome browser

More...
UCSCi
uc001tgd.3 human [Q7Z6G8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY281131 mRNA Translation: AAP37612.1
AY281132 mRNA Translation: AAP37613.1
AY283057 mRNA Translation: AAP38184.2 Different initiation.
AY753193 mRNA Translation: AAV28691.1
AF164792 mRNA Translation: AAF80756.1
AK289768 mRNA Translation: BAF82457.1
AK294191 mRNA Translation: BAG57507.1
AK294994 mRNA Translation: BAG58059.1
AC008126 Genomic DNA No translation available.
AC011248 Genomic DNA No translation available.
AC021653 Genomic DNA No translation available.
AC048330 Genomic DNA No translation available.
AC069437 Genomic DNA No translation available.
AC078916 Genomic DNA No translation available.
AC079954 Genomic DNA No translation available.
AC084374 Genomic DNA No translation available.
AC117377 Genomic DNA No translation available.
AC126616 Genomic DNA No translation available.
AC141554 Genomic DNA No translation available.
AC141555 Genomic DNA No translation available.
AC141556 Genomic DNA No translation available.
BC026313 mRNA Translation: AAH26313.2
BC068451 mRNA Translation: AAH68451.1
BC142669 mRNA Translation: AAI42670.1
BC150204 mRNA Translation: AAI50205.1
AF145204 mRNA Translation: AAD33951.1
AY620824 mRNA Translation: AAT39519.1
CCDSiCCDS55864.1 [Q7Z6G8-9]
CCDS55865.1 [Q7Z6G8-8]
CCDS55866.1 [Q7Z6G8-7]
CCDS55867.1 [Q7Z6G8-2]
CCDS55868.1 [Q7Z6G8-5]
CCDS55869.1 [Q7Z6G8-4]
CCDS55870.1 [Q7Z6G8-3]
CCDS55871.1 [Q7Z6G8-10]
CCDS55872.1 [Q7Z6G8-1]
RefSeqiNP_001190994.1, NM_001204065.1
NP_001190995.1, NM_001204066.1 [Q7Z6G8-8]
NP_001190996.1, NM_001204067.1 [Q7Z6G8-10]
NP_001190997.1, NM_001204068.1 [Q7Z6G8-4]
NP_001190998.1, NM_001204069.1 [Q7Z6G8-5]
NP_001190999.1, NM_001204070.1 [Q7Z6G8-2]
NP_001191008.1, NM_001204079.1
NP_001191009.1, NM_001204080.1
NP_001191010.1, NM_001204081.1 [Q7Z6G8-9]
NP_064525.1, NM_020140.3 [Q7Z6G8-7]
NP_690001.3, NM_152788.4 [Q7Z6G8-1]
NP_858056.2, NM_181670.3 [Q7Z6G8-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EAMNMR-A808-874[»]
2KE7NMR-A808-893[»]
2KIVNMR-A812-946[»]
2M38NMR-A1042-1194[»]
SMRiQ7Z6G8
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi121229, 10 interactors
DIPiDIP-41406N
IntActiQ7Z6G8, 11 interactors
MINTiQ7Z6G8
STRINGi9606.ENSP00000449629

PTM databases

iPTMnetiQ7Z6G8
PhosphoSitePlusiQ7Z6G8
SwissPalmiQ7Z6G8

Polymorphism and mutation databases

BioMutaiANKS1B
DMDMi332278155

Proteomic databases

EPDiQ7Z6G8
jPOSTiQ7Z6G8
MassIVEiQ7Z6G8
MaxQBiQ7Z6G8
PaxDbiQ7Z6G8
PeptideAtlasiQ7Z6G8
PRIDEiQ7Z6G8
ProteomicsDBi28297
29375
31007
69401 [Q7Z6G8-1]
69402 [Q7Z6G8-2]
69403 [Q7Z6G8-3]
69404 [Q7Z6G8-4]
69405 [Q7Z6G8-5]
69406 [Q7Z6G8-6]
69407 [Q7Z6G8-7]
69408 [Q7Z6G8-8]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
56899

Genome annotation databases

EnsembliENST00000341752; ENSP00000345510; ENSG00000185046 [Q7Z6G8-9]
ENST00000546568; ENSP00000448205; ENSG00000185046 [Q7Z6G8-2]
ENST00000546960; ENSP00000447839; ENSG00000185046 [Q7Z6G8-4]
ENST00000547010; ENSP00000448512; ENSG00000185046 [Q7Z6G8-6]
ENST00000547446; ENSP00000450015; ENSG00000185046 [Q7Z6G8-10]
ENST00000547776; ENSP00000449629; ENSG00000185046 [Q7Z6G8-1]
ENST00000549025; ENSP00000447312; ENSG00000185046 [Q7Z6G8-8]
ENST00000549493; ENSP00000448203; ENSG00000185046 [Q7Z6G8-3]
ENST00000549558; ENSP00000448993; ENSG00000185046 [Q7Z6G8-7]
ENST00000550693; ENSP00000447999; ENSG00000185046 [Q7Z6G8-5]
GeneIDi56899
KEGGihsa:56899
UCSCiuc001tgd.3 human [Q7Z6G8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
56899
DisGeNETi56899

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ANKS1B
HGNCiHGNC:24600 ANKS1B
HPAiHPA044628
MIMi607815 gene
neXtProtiNX_Q7Z6G8
OpenTargetsiENSG00000185046
PharmGKBiPA128394692

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0507 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00940000154572
HOGENOMiHOG000007214
InParanoidiQ7Z6G8
KOiK21413
OMAiQQEDNDP
OrthoDBi549581at2759
TreeFamiTF320582

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ANKS1B human
EvolutionaryTraceiQ7Z6G8

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ANKS1B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
56899
PharosiQ7Z6G8

Protein Ontology

More...
PROi
PR:Q7Z6G8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000185046 Expressed in 154 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ7Z6G8 baseline and differential
GenevisibleiQ7Z6G8 HS

Family and domain databases

CDDicd09499 SAM_AIDA1AB-like_repeat1, 1 hit
cd09500 SAM_AIDA1AB-like_repeat2, 1 hit
Gene3Di1.10.150.50, 2 hits
1.25.40.20, 2 hits
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR033636 ANKS1B
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
IPR001660 SAM
IPR013761 SAM/pointed_sf
IPR041880 SAM_ANKS1_repeat1
IPR041882 SAM_ANKS1_repeat2
PANTHERiPTHR24174:SF3 PTHR24174:SF3, 1 hit
PfamiView protein in Pfam
PF12796 Ank_2, 3 hits
PF00640 PID, 1 hit
PF00536 SAM_1, 2 hits
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 6 hits
SM00462 PTB, 1 hit
SM00454 SAM, 2 hits
SUPFAMiSSF47769 SSF47769, 2 hits
SSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 5 hits
PS01179 PID, 1 hit
PS50105 SAM_DOMAIN, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANS1B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7Z6G8
Secondary accession number(s): A5PKY5
, A7E259, A8K153, A8MSN4, B4DFP6, B4DH98, F8VPM3, F8VZR9, F8WC27, Q5XLJ0, Q6IVB5, Q6NUS4, Q7Z6G6, Q7Z6G7, Q8TAP3, Q9NRX7, Q9Y5K9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: May 3, 2011
Last modified: October 16, 2019
This is version 142 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again