Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SLIT-ROBO Rho GTPase-activating protein 1

Gene

SRGAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTPase-activating protein for RhoA and Cdc42 small GTPases. Together with CDC42 seems to be involved in the pathway mediating the repulsive signaling of Robo and Slit proteins in neuronal migration. SLIT2, probably through interaction with ROBO1, increases the interaction of SRGAP1 with ROBO1 and inactivates CDC42.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTPase activator activity Source: Reactome
  • Rac GTPase binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-194840 Rho GTPase cycle
R-HSA-428543 Inactivation of CDC42 and RAC1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SLIT-ROBO Rho GTPase-activating protein 1
Short name:
srGAP1
Alternative name(s):
Rho GTPase-activating protein 13
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SRGAP1
Synonyms:ARHGAP13, KIAA1304
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000196935.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17382 SRGAP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606523 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7Z6B7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Thyroid cancer, non-medullary, 2 (NMTC2)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA form of non-medullary thyroid cancer (NMTC), a cancer characterized by tumors originating from the thyroid follicular cells. NMTCs represent approximately 95% of all cases of thyroid cancer and are classified into papillary, follicular, Hurthle cell, and anaplastic neoplasms.
See also OMIM:188470
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_075879149Q → H in NMTC2; does not affect the interaction with ROBO1; decreased GTPase activator activity; in SLIT2 and ROBO1-mediated inhibition of CDC42. 1 PublicationCorresponds to variant dbSNP:rs781626187EnsemblClinVar.1
Natural variantiVAR_075880275A → T in NMTC2; does not affect the interaction with ROBO1; slightly increased GTPase activator activity; in SLIT2 and ROBO1-mediated inhibition of CDC42. 1 PublicationCorresponds to variant dbSNP:rs797044990EnsemblClinVar.1
Natural variantiVAR_075882617R → C in NMTC2; does not affect the interaction with ROBO1; decreased GTPase activator activity; in SLIT2 and ROBO1-mediated inhibition of CDC42. 1 PublicationCorresponds to variant dbSNP:rs114817817EnsemblClinVar.1
Natural variantiVAR_075883875H → R in NMTC2; does not affect the interaction with ROBO1; slightly increased GTPase activator activity; in SLIT2 and ROBO1-mediated inhibition of CDC42. 1 PublicationCorresponds to variant dbSNP:rs61754221Ensembl.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
57522

MalaCards human disease database

More...
MalaCardsi
SRGAP1
MIMi188470 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000196935

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134887956

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SRGAP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
48428624

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000567651 – 1085SLIT-ROBO Rho GTPase-activating protein 1Add BLAST1085

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei416PhosphoserineCombined sources1
Modified residuei835PhosphoserineCombined sources1
Modified residuei917PhosphoserineCombined sources1
Modified residuei932PhosphoserineCombined sources1
Modified residuei999PhosphoserineCombined sources1
Modified residuei1001PhosphothreonineCombined sources1
Modified residuei1032PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7Z6B7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q7Z6B7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7Z6B7

PeptideAtlas

More...
PeptideAtlasi
Q7Z6B7

PRoteomics IDEntifications database

More...
PRIDEi
Q7Z6B7

ProteomicsDB human proteome resource

More...
ProteomicsDBi
69392
69393 [Q7Z6B7-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7Z6B7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7Z6B7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain, lung, kidney, and testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000196935 Expressed in 193 organ(s), highest expression level in neocortex

CleanEx database of gene expression profiles

More...
CleanExi
HS_SRGAP1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7Z6B7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7Z6B7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA052416

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (Probable). Forms a heterooligomer with SRGAP2 and SRGAP3 through its F-BAR domain. Interacts with ROBO1, CDC42 and RHOA. Interacts with FASLG.Curated2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121583, 9 interactors

Database of interacting proteins

More...
DIPi
DIP-53826N

Protein interaction database and analysis system

More...
IntActi
Q7Z6B7, 9 interactors

Molecular INTeraction database

More...
MINTi
Q7Z6B7

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000347198

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q7Z6B7

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7Z6B7

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini19 – 314F-BARPROSITE-ProRule annotationAdd BLAST296
Domaini506 – 694Rho-GAPPROSITE-ProRule annotationAdd BLAST189
Domaini743 – 802SH3PROSITE-ProRule annotationAdd BLAST60

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili351 – 390Sequence analysisAdd BLAST40
Coiled coili956 – 985Sequence analysisAdd BLAST30

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi854 – 857Poly-Pro4
Compositional biasi909 – 912Poly-Arg4
Compositional biasi1027 – 1032Poly-Ser6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The F-BAR domain mediates oligomerization, binds membranes, and constrains plasma membrane protrusions.1 Publication

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3565 Eukaryota
ENOG410XS44 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153559

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000039980

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG051637

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7Z6B7

KEGG Orthology (KO)

More...
KOi
K07526

Identification of Orthologs from Complete Genome Data

More...
OMAi
TAFCPPM

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0113

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7Z6B7

TreeFam database of animal gene trees

More...
TreeFami
TF315892

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07683 F-BAR_srGAP1, 1 hit
cd11955 SH3_srGAP1-3, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.555.10, 1 hit
1.20.1270.60, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR031160 F_BAR
IPR001060 FCH_dom
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR035648 srGAP1/2/3_SH3
IPR037451 srGAP1_F-BAR

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00611 FCH, 1 hit
PF00620 RhoGAP, 1 hit
PF00018 SH3_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00055 FCH, 1 hit
SM00324 RhoGAP, 1 hit
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103657 SSF103657, 1 hit
SSF48350 SSF48350, 1 hit
SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51741 F_BAR, 1 hit
PS50238 RHOGAP, 1 hit
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z6B7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTPSRFKKD KEIIAEYESQ VKEIRAQLVE QQKCLEQQTE MRVQLLQDLQ
60 70 80 90 100
DFFRKKAEIE TEYSRNLEKL AERFMAKTRS TKDHQQYKKD QNLLSPVNCW
110 120 130 140 150
YLLLNQVRRE SKDHATLSDI YLNNVIMRFM QISEDSTRMF KKSKEIAFQL
160 170 180 190 200
HEDLMKVLNE LYTVMKTYHM YHAESISAES KLKEAEKQEE KQIGRSGDPV
210 220 230 240 250
FHIRLEERHQ RRSSVKKIEK MKEKRQAKYS ENKLKSIKAR NEYLLTLEAT
260 270 280 290 300
NASVFKYYIH DLSDLIDCCD LGYHASLNRA LRTYLSAEYN LETSRHEGLD
310 320 330 340 350
IIENAVDNLE PRSDKQRFME MYPAAFCPPM KFEFQSHMGD EVCQVSAQQP
360 370 380 390 400
VQAELMLRYQ QLQSRLATLK IENEEVKKTT EATLQTIQDM VTIEDYDVSE
410 420 430 440 450
CFQHSRSTES VKSTVSETYL SKPSIAKRRA NQQETEQFYF MKLREYLEGS
460 470 480 490 500
NLITKLQAKH DLLQRTLGEG HRAEYMTTRP PNVPPKPQKH RKSRPRSQYN
510 520 530 540 550
TKLFNGDLET FVKDSGQVIP LIVESCIRFI NLYGLQHQGI FRVSGSQVEV
560 570 580 590 600
NDIKNSFERG ENPLADDQSN HDINSVAGVL KLYFRGLENP LFPKERFNDL
610 620 630 640 650
ISCIRIDNLY ERALHIRKLL LTLPRSVLIV MRYLFAFLNH LSQYSDENMM
660 670 680 690 700
DPYNLAICFG PTLMPVPEIQ DQVSCQAHVN EIIKTIIIHH ETIFPDAKEL
710 720 730 740 750
DGPVYEKCMA GDDYCDSPYS EHGTLEEVDQ DAGTEPHTSE DECEPIEAIA
760 770 780 790 800
KFDYVGRSAR ELSFKKGASL LLYHRASEDW WEGRHNGIDG LVPHQYIVVQ
810 820 830 840 850
DMDDTFSDTL SQKADSEASS GPVTEDKSSS KDMNSPTDRH PDGYLARQRK
860 870 880 890 900
RGEPPPPVRR PGRTSDGHCP LHPPHALSNS SVDLGSPSLA SHPRGLLQNR
910 920 930 940 950
GLNNDSPERR RRPGHGSLTN ISRHDSLKKI DSPPIRRSTS SGQYTGFNDH
960 970 980 990 1000
KPLDPETIAQ DIEETMNTAL NELRELERQS TAKHAPDVVL DTLEQVKNSP
1010 1020 1030 1040 1050
TPATSTESLS PLHNVALRSS EPQIRRSTSS SSDTMSTFKP MVAPRMGVQL
1060 1070 1080
KPPALRPKPA VLPKTNPTIG PAPPPQGPTD KSCTM
Length:1,085
Mass (Da):124,264
Last modified:October 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD7ED1F651344F0D9
GO
Isoform 2 (identifier: Q7Z6B7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     479-513: RPPNVPPKPQKHRKSRPRSQYNTKLFNGDLETFVK → SRGRRNSHTRHQ

Note: No experimental confirmation available.
Show »
Length:1,062
Mass (Da):121,594
Checksum:iC9872F6AA2825358
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G5EA48G5EA48_HUMAN
SLIT-ROBO Rho GTPase activating pro...
SRGAP1 hCG_1818050
1,022Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA92542 differs from that shown. Intron retention.Curated
The sequence BAA92542 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_075879149Q → H in NMTC2; does not affect the interaction with ROBO1; decreased GTPase activator activity; in SLIT2 and ROBO1-mediated inhibition of CDC42. 1 PublicationCorresponds to variant dbSNP:rs781626187EnsemblClinVar.1
Natural variantiVAR_075880275A → T in NMTC2; does not affect the interaction with ROBO1; slightly increased GTPase activator activity; in SLIT2 and ROBO1-mediated inhibition of CDC42. 1 PublicationCorresponds to variant dbSNP:rs797044990EnsemblClinVar.1
Natural variantiVAR_075881512V → I1 PublicationCorresponds to variant dbSNP:rs74691643Ensembl.1
Natural variantiVAR_075882617R → C in NMTC2; does not affect the interaction with ROBO1; decreased GTPase activator activity; in SLIT2 and ROBO1-mediated inhibition of CDC42. 1 PublicationCorresponds to variant dbSNP:rs114817817EnsemblClinVar.1
Natural variantiVAR_075883875H → R in NMTC2; does not affect the interaction with ROBO1; slightly increased GTPase activator activity; in SLIT2 and ROBO1-mediated inhibition of CDC42. 1 PublicationCorresponds to variant dbSNP:rs61754221Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_010580479 – 513RPPNV…ETFVK → SRGRRNSHTRHQ in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BC053903 mRNA Translation: AAH53903.1
AB037725 mRNA Translation: BAA92542.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS8967.1 [Q7Z6B7-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
G59436

NCBI Reference Sequences

More...
RefSeqi
NP_001333130.1, NM_001346201.1 [Q7Z6B7-2]
NP_065813.1, NM_020762.3 [Q7Z6B7-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.210751
Hs.593803

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000355086; ENSP00000347198; ENSG00000196935 [Q7Z6B7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57522

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57522

UCSC genome browser

More...
UCSCi
uc010ssp.2 human [Q7Z6B7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC053903 mRNA Translation: AAH53903.1
AB037725 mRNA Translation: BAA92542.1 Different initiation.
CCDSiCCDS8967.1 [Q7Z6B7-1]
PIRiG59436
RefSeqiNP_001333130.1, NM_001346201.1 [Q7Z6B7-2]
NP_065813.1, NM_020762.3 [Q7Z6B7-1]
UniGeneiHs.210751
Hs.593803

3D structure databases

ProteinModelPortaliQ7Z6B7
SMRiQ7Z6B7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121583, 9 interactors
DIPiDIP-53826N
IntActiQ7Z6B7, 9 interactors
MINTiQ7Z6B7
STRINGi9606.ENSP00000347198

PTM databases

iPTMnetiQ7Z6B7
PhosphoSitePlusiQ7Z6B7

Polymorphism and mutation databases

BioMutaiSRGAP1
DMDMi48428624

Proteomic databases

EPDiQ7Z6B7
MaxQBiQ7Z6B7
PaxDbiQ7Z6B7
PeptideAtlasiQ7Z6B7
PRIDEiQ7Z6B7
ProteomicsDBi69392
69393 [Q7Z6B7-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
57522
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355086; ENSP00000347198; ENSG00000196935 [Q7Z6B7-1]
GeneIDi57522
KEGGihsa:57522
UCSCiuc010ssp.2 human [Q7Z6B7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57522
DisGeNETi57522
EuPathDBiHostDB:ENSG00000196935.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SRGAP1
HGNCiHGNC:17382 SRGAP1
HPAiHPA052416
MalaCardsiSRGAP1
MIMi188470 phenotype
606523 gene
neXtProtiNX_Q7Z6B7
OpenTargetsiENSG00000196935
PharmGKBiPA134887956

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3565 Eukaryota
ENOG410XS44 LUCA
GeneTreeiENSGT00940000153559
HOGENOMiHOG000039980
HOVERGENiHBG051637
InParanoidiQ7Z6B7
KOiK07526
OMAiTAFCPPM
OrthoDBiEOG091G0113
PhylomeDBiQ7Z6B7
TreeFamiTF315892

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle
R-HSA-428543 Inactivation of CDC42 and RAC1

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SRGAP1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SRGAP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57522

Protein Ontology

More...
PROi
PR:Q7Z6B7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000196935 Expressed in 193 organ(s), highest expression level in neocortex
CleanExiHS_SRGAP1
ExpressionAtlasiQ7Z6B7 baseline and differential
GenevisibleiQ7Z6B7 HS

Family and domain databases

CDDicd07683 F-BAR_srGAP1, 1 hit
cd11955 SH3_srGAP1-3, 1 hit
Gene3Di1.10.555.10, 1 hit
1.20.1270.60, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR031160 F_BAR
IPR001060 FCH_dom
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR035648 srGAP1/2/3_SH3
IPR037451 srGAP1_F-BAR
PfamiView protein in Pfam
PF00611 FCH, 1 hit
PF00620 RhoGAP, 1 hit
PF00018 SH3_1, 1 hit
SMARTiView protein in SMART
SM00055 FCH, 1 hit
SM00324 RhoGAP, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF103657 SSF103657, 1 hit
SSF48350 SSF48350, 1 hit
SSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS51741 F_BAR, 1 hit
PS50238 RHOGAP, 1 hit
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSRGP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7Z6B7
Secondary accession number(s): Q9H8A3, Q9P2P2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2004
Last sequence update: October 1, 2003
Last modified: December 5, 2018
This is version 147 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again