Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q7Z614 (SNX20_HUMAN)

Entry version 137 (07 Apr 2021)
Sequence version 1 (01 Oct 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Sorting nexin-20

Gene

SNX20

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in cellular vesicle trafficking. Has been proposed to function as a sorting protein that targets SELPLG into endosomes, but has no effect on SELPLG internalization from the cell surface, or on SELPLG-mediated cell-cell adhesion.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei116Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei118Phosphatidylinositol 3-phosphate; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei143Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei157Phosphatidylinositol 3-phosphateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport
LigandLipid-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q7Z614

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sorting nexin-20
Alternative name(s):
Selectin ligand-interactor cytoplasmic 11 Publication
Short name:
SLIC-11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SNX20
Synonyms:SLIC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:30390, SNX20

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		613281, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q7Z614

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000167208.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endosome, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi116R → Q: Decreased binding activity to all phospholipids. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		124460

Open Targets

More...OpenTargetsi		ENSG00000167208

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162404311

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q7Z614, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SNX20

Domain mapping of disease mutations (DMDM)

More...DMDMi		74713704

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003258201 – 316Sorting nexin-20Add BLAST316

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei3PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q7Z614

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q7Z614

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q7Z614

PeptideAtlas

More...PeptideAtlasi		Q7Z614

PRoteomics IDEntifications database

More...PRIDEi		Q7Z614

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		69364 [Q7Z614-1]
69365 [Q7Z614-2]
69366 [Q7Z614-3]
69367 [Q7Z614-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q7Z614

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q7Z614

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000167208, Expressed in granulocyte and 155 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q7Z614, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q7Z614, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000167208, Group enriched (blood, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SELPLG (PubMed:18196517). Interaction with SELPLG is controversial.

Curated1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		125867, 20 interactors

Protein interaction database and analysis system

More...IntActi		Q7Z614, 23 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000332062

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q7Z614, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q7Z614

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini74 – 191PXPROSITE-ProRule annotationAdd BLAST118

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PX domain binds phosphatidylinositol 3-phosphate which is necessary for localization to the endosomes.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the sorting nexin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2101, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00530000063759

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_160093_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q7Z614

Identification of Orthologs from Complete Genome Data

More...OMAi		YVMYKII

Database of Orthologous Groups

More...OrthoDBi		1322681at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q7Z614

TreeFam database of animal gene trees

More...TreeFami		TF326807

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.25.40.10, 1 hit
3.30.1520.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001683, PX_dom
IPR036871, PX_dom_sf
IPR039937, SNX20/SNX21
IPR011990, TPR-like_helical_dom_sf

The PANTHER Classification System

More...PANTHERi		PTHR20939, PTHR20939, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00787, PX, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00312, PX, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF64268, SSF64268, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50195, PX, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z614-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASPEHPGSP GCMGPITQCT ARTQQEAPAT GPDLPHPGPD GHLDTHSGLS 
        60         70         80         90        100
SNSSMTTREL QQYWQNQKCR WKHVKLLFEI ASARIEERKV SKFVVYQIIV 
       110        120        130        140        150
IQTGSFDNNK AVLERRYSDF AKLQKALLKT FREEIEDVEF PRKHLTGNFA 
       160        170        180        190        200
EEMICERRRA LQEYLGLLYA IRCVRRSREF LDFLTRPELR EAFGCLRAGQ 
       210        220        230        240        250
YPRALELLLR VLPLQEKLTA HCPAAAVPAL CAVLLCHRDL DRPAEAFAAG 
       260        270        280        290        300
ERALQRLQAR EGHRYYAPLL DAMVRLAYAL GKDFVTLQER LEESQLRRPT 
       310 
PRGITLKELT VREYLH
Length:316
Mass (Da):36,178
Last modified:October 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i48D06CF4490907F4
GO
Isoform 2 (identifier: Q7Z614-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-284: Missing.

Show »
Length:152
Mass (Da):17,314
Checksum:iE9E2EE4EDE3AAC46
GO
Isoform 3 (identifier: Q7Z614-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-129: VYQIIVIQTGSFDNNKAVLERRYSDFAKLQKALLK → MGKSRPGEMTYPGSRGETGTAPEPDPRCPRQSDML
     130-316: Missing.

Show »
Length:129
Mass (Da):14,186
Checksum:i7037F3ABC0033C43
GO
Isoform 4 (identifier: Q7Z614-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-102: VYQIIVIQ → APAPDATP
     103-316: Missing.

Show »
Length:102
Mass (Da):11,131
Checksum:i47D9A565C2C63833
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X2C1A0A087X2C1_HUMAN
Sorting nexin-20
SNX20
152Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03992735P → L1 PublicationCorresponds to variant dbSNP:rs1131716Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03242595 – 129VYQII…KALLK → MGKSRPGEMTYPGSRGETGT APEPDPRCPRQSDML in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_03242695 – 102VYQIIVIQ → APAPDATP in isoform 4. 2 Publications8
Alternative sequenceiVSP_032427103 – 316Missing in isoform 4. 2 PublicationsAdd BLAST214
Alternative sequenceiVSP_032428121 – 284Missing in isoform 2. 1 PublicationAdd BLAST164
Alternative sequenceiVSP_032429130 – 316Missing in isoform 3. 1 PublicationAdd BLAST187

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY302441 mRNA Translation: AAP58362.1
AK292650 mRNA Translation: BAF85339.1
AK292705 mRNA Translation: BAF85394.1
CH471092 Genomic DNA Translation: EAW82763.1
BC063423 mRNA Translation: AAH63423.1
BC119626 mRNA Translation: AAI19627.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10744.1 [Q7Z614-3]
CCDS10745.1 [Q7Z614-1]
CCDS45481.1 [Q7Z614-4]

NCBI Reference Sequences

More...RefSeqi		NP_001138444.1, NM_001144972.1 [Q7Z614-4]
NP_699168.1, NM_153337.2 [Q7Z614-3]
NP_878274.1, NM_182854.3 [Q7Z614-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000300590; ENSP00000300590; ENSG00000167208 [Q7Z614-3]
ENST00000330943; ENSP00000332062; ENSG00000167208 [Q7Z614-1]
ENST00000423026; ENSP00000388875; ENSG00000167208 [Q7Z614-4]
ENST00000568993; ENSP00000454863; ENSG00000167208 [Q7Z614-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		124460

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:124460

UCSC genome browser

More...UCSCi		uc002egi.4, human [Q7Z614-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY302441 mRNA Translation: AAP58362.1
AK292650 mRNA Translation: BAF85339.1
AK292705 mRNA Translation: BAF85394.1
CH471092 Genomic DNA Translation: EAW82763.1
BC063423 mRNA Translation: AAH63423.1
BC119626 mRNA Translation: AAI19627.1
CCDSiCCDS10744.1 [Q7Z614-3]
CCDS10745.1 [Q7Z614-1]
CCDS45481.1 [Q7Z614-4]
RefSeqiNP_001138444.1, NM_001144972.1 [Q7Z614-4]
NP_699168.1, NM_153337.2 [Q7Z614-3]
NP_878274.1, NM_182854.3 [Q7Z614-1]

3D structure databases

SMRiQ7Z614
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi125867, 20 interactors
IntActiQ7Z614, 23 interactors
STRINGi9606.ENSP00000332062

PTM databases

iPTMnetiQ7Z614
PhosphoSitePlusiQ7Z614

Genetic variation databases

BioMutaiSNX20
DMDMi74713704

Proteomic databases

jPOSTiQ7Z614
MassIVEiQ7Z614
PaxDbiQ7Z614
PeptideAtlasiQ7Z614
PRIDEiQ7Z614
ProteomicsDBi69364 [Q7Z614-1]
69365 [Q7Z614-2]
69366 [Q7Z614-3]
69367 [Q7Z614-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		28297, 85 antibodies

The DNASU plasmid repository

More...DNASUi		124460

Genome annotation databases

EnsembliENST00000300590; ENSP00000300590; ENSG00000167208 [Q7Z614-3]
ENST00000330943; ENSP00000332062; ENSG00000167208 [Q7Z614-1]
ENST00000423026; ENSP00000388875; ENSG00000167208 [Q7Z614-4]
ENST00000568993; ENSP00000454863; ENSG00000167208 [Q7Z614-3]
GeneIDi124460
KEGGihsa:124460
UCSCiuc002egi.4, human [Q7Z614-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		124460
DisGeNETi124460

GeneCards: human genes, protein and diseases

More...GeneCardsi		SNX20
HGNCiHGNC:30390, SNX20
HPAiENSG00000167208, Group enriched (blood, lymphoid tissue)
MIMi613281, gene
neXtProtiNX_Q7Z614
OpenTargetsiENSG00000167208
PharmGKBiPA162404311
VEuPathDBiHostDB:ENSG00000167208.14

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2101, Eukaryota
GeneTreeiENSGT00530000063759
HOGENOMiCLU_160093_0_0_1
InParanoidiQ7Z614
OMAiYVMYKII
OrthoDBi1322681at2759
PhylomeDBiQ7Z614
TreeFamiTF326807

Enzyme and pathway databases

PathwayCommonsiQ7Z614

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		124460, 5 hits in 990 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SNX20, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		124460
PharosiQ7Z614, Tdark

Protein Ontology

More...PROi		PR:Q7Z614
RNActiQ7Z614, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000167208, Expressed in granulocyte and 155 other tissues
ExpressionAtlasiQ7Z614, baseline and differential
GenevisibleiQ7Z614, HS

Family and domain databases

Gene3Di1.25.40.10, 1 hit
3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR001683, PX_dom
IPR036871, PX_dom_sf
IPR039937, SNX20/SNX21
IPR011990, TPR-like_helical_dom_sf
PANTHERiPTHR20939, PTHR20939, 1 hit
PfamiView protein in Pfam
PF00787, PX, 1 hit
SMARTiView protein in SMART
SM00312, PX, 1 hit
SUPFAMiSSF64268, SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50195, PX, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSNX20_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7Z614
Secondary accession number(s): A8K9D5
, Q08E98, Q6P4H2, Q8IV59
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: October 1, 2003
Last modified: April 7, 2021
This is version 137 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again