Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sorting nexin-20

Gene

SNX20

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in cellular vesicle trafficking. Has been proposed to function as a sorting protein that targets SELPLG into endosomes, but has no effect on SELPLG internalization from the cell surface, or on SELPLG-mediated cell-cell adhesion.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei116Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei118Phosphatidylinositol 3-phosphate; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei143Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei157Phosphatidylinositol 3-phosphateBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processProtein transport, Transport
LigandLipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Sorting nexin-20
Alternative name(s):
Selectin ligand-interactor cytoplasmic 11 Publication
Short name:
SLIC-11 Publication
Gene namesi
Name:SNX20
Synonyms:SLIC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000167208.14
HGNCiHGNC:30390 SNX20
MIMi613281 gene
neXtProtiNX_Q7Z614

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endosome, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi116R → Q: Decreased binding activity to all phospholipids. 1 Publication1

Organism-specific databases

DisGeNETi124460
OpenTargetsiENSG00000167208
PharmGKBiPA162404311

Polymorphism and mutation databases

BioMutaiSNX20
DMDMi74713704

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003258201 – 316Sorting nexin-20Add BLAST316

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei3PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ7Z614
PeptideAtlasiQ7Z614
PRIDEiQ7Z614
ProteomicsDBi69364
69365 [Q7Z614-2]
69366 [Q7Z614-3]
69367 [Q7Z614-4]

PTM databases

iPTMnetiQ7Z614
PhosphoSitePlusiQ7Z614

Expressioni

Gene expression databases

BgeeiENSG00000167208 Expressed in 137 organ(s), highest expression level in blood
CleanExiHS_SNX20
ExpressionAtlasiQ7Z614 baseline and differential
GenevisibleiQ7Z614 HS

Organism-specific databases

HPAiHPA043649

Interactioni

Subunit structurei

Interacts with SELPLG (PubMed:18196517). Interaction with SELPLG is controversial.Curated1 Publication

Binary interactionsi

Protein-protein interaction databases

BioGridi125867, 19 interactors
IntActiQ7Z614, 9 interactors
STRINGi9606.ENSP00000332062

Structurei

3D structure databases

ProteinModelPortaliQ7Z614
SMRiQ7Z614
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini74 – 191PXPROSITE-ProRule annotationAdd BLAST118

Domaini

The PX domain binds phosphatidylinositol 3-phosphate which is necessary for localization to the endosomes.1 Publication

Sequence similaritiesi

Belongs to the sorting nexin family.Curated

Phylogenomic databases

eggNOGiENOG410IMHU Eukaryota
ENOG41114JN LUCA
GeneTreeiENSGT00530000063759
HOGENOMiHOG000154363
HOVERGENiHBG108497
InParanoidiQ7Z614
KOiK17931
OMAiCLRAGQY
OrthoDBiEOG091G0S8F
PhylomeDBiQ7Z614
TreeFamiTF326807

Family and domain databases

Gene3Di1.25.40.10, 1 hit
3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR001683 Phox
IPR036871 PX_dom_sf
IPR011990 TPR-like_helical_dom_sf
PfamiView protein in Pfam
PF00787 PX, 1 hit
SMARTiView protein in SMART
SM00312 PX, 1 hit
SUPFAMiSSF64268 SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50195 PX, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.iShow all

Isoform 1 (identifier: Q7Z614-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASPEHPGSP GCMGPITQCT ARTQQEAPAT GPDLPHPGPD GHLDTHSGLS
60 70 80 90 100
SNSSMTTREL QQYWQNQKCR WKHVKLLFEI ASARIEERKV SKFVVYQIIV
110 120 130 140 150
IQTGSFDNNK AVLERRYSDF AKLQKALLKT FREEIEDVEF PRKHLTGNFA
160 170 180 190 200
EEMICERRRA LQEYLGLLYA IRCVRRSREF LDFLTRPELR EAFGCLRAGQ
210 220 230 240 250
YPRALELLLR VLPLQEKLTA HCPAAAVPAL CAVLLCHRDL DRPAEAFAAG
260 270 280 290 300
ERALQRLQAR EGHRYYAPLL DAMVRLAYAL GKDFVTLQER LEESQLRRPT
310
PRGITLKELT VREYLH
Length:316
Mass (Da):36,178
Last modified:October 1, 2003 - v1
Checksum:i48D06CF4490907F4
GO
Isoform 2 (identifier: Q7Z614-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-284: Missing.

Show »
Length:152
Mass (Da):17,314
Checksum:iE9E2EE4EDE3AAC46
GO
Isoform 3 (identifier: Q7Z614-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-129: VYQIIVIQTGSFDNNKAVLERRYSDFAKLQKALLK → MGKSRPGEMTYPGSRGETGTAPEPDPRCPRQSDML
     130-316: Missing.

Show »
Length:129
Mass (Da):14,186
Checksum:i7037F3ABC0033C43
GO
Isoform 4 (identifier: Q7Z614-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-102: VYQIIVIQ → APAPDATP
     103-316: Missing.

Show »
Length:102
Mass (Da):11,131
Checksum:i47D9A565C2C63833
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X2C1A0A087X2C1_HUMAN
Sorting nexin-20
SNX20
152Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03992735P → L1 PublicationCorresponds to variant dbSNP:rs1131716Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03242595 – 129VYQII…KALLK → MGKSRPGEMTYPGSRGETGT APEPDPRCPRQSDML in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_03242695 – 102VYQIIVIQ → APAPDATP in isoform 4. 2 Publications8
Alternative sequenceiVSP_032427103 – 316Missing in isoform 4. 2 PublicationsAdd BLAST214
Alternative sequenceiVSP_032428121 – 284Missing in isoform 2. 1 PublicationAdd BLAST164
Alternative sequenceiVSP_032429130 – 316Missing in isoform 3. 1 PublicationAdd BLAST187

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY302441 mRNA Translation: AAP58362.1
AK292650 mRNA Translation: BAF85339.1
AK292705 mRNA Translation: BAF85394.1
CH471092 Genomic DNA Translation: EAW82763.1
BC063423 mRNA Translation: AAH63423.1
BC119626 mRNA Translation: AAI19627.1
CCDSiCCDS10744.1 [Q7Z614-3]
CCDS10745.1 [Q7Z614-1]
CCDS45481.1 [Q7Z614-4]
RefSeqiNP_001138444.1, NM_001144972.1 [Q7Z614-4]
NP_699168.1, NM_153337.2 [Q7Z614-3]
NP_878274.1, NM_182854.3 [Q7Z614-1]
UniGeneiHs.460777
Hs.660456
Hs.715778

Genome annotation databases

EnsembliENST00000300590; ENSP00000300590; ENSG00000167208 [Q7Z614-3]
ENST00000330943; ENSP00000332062; ENSG00000167208 [Q7Z614-1]
ENST00000423026; ENSP00000388875; ENSG00000167208 [Q7Z614-4]
ENST00000568993; ENSP00000454863; ENSG00000167208 [Q7Z614-3]
GeneIDi124460
KEGGihsa:124460
UCSCiuc002egi.4 human [Q7Z614-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY302441 mRNA Translation: AAP58362.1
AK292650 mRNA Translation: BAF85339.1
AK292705 mRNA Translation: BAF85394.1
CH471092 Genomic DNA Translation: EAW82763.1
BC063423 mRNA Translation: AAH63423.1
BC119626 mRNA Translation: AAI19627.1
CCDSiCCDS10744.1 [Q7Z614-3]
CCDS10745.1 [Q7Z614-1]
CCDS45481.1 [Q7Z614-4]
RefSeqiNP_001138444.1, NM_001144972.1 [Q7Z614-4]
NP_699168.1, NM_153337.2 [Q7Z614-3]
NP_878274.1, NM_182854.3 [Q7Z614-1]
UniGeneiHs.460777
Hs.660456
Hs.715778

3D structure databases

ProteinModelPortaliQ7Z614
SMRiQ7Z614
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125867, 19 interactors
IntActiQ7Z614, 9 interactors
STRINGi9606.ENSP00000332062

PTM databases

iPTMnetiQ7Z614
PhosphoSitePlusiQ7Z614

Polymorphism and mutation databases

BioMutaiSNX20
DMDMi74713704

Proteomic databases

PaxDbiQ7Z614
PeptideAtlasiQ7Z614
PRIDEiQ7Z614
ProteomicsDBi69364
69365 [Q7Z614-2]
69366 [Q7Z614-3]
69367 [Q7Z614-4]

Protocols and materials databases

DNASUi124460
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300590; ENSP00000300590; ENSG00000167208 [Q7Z614-3]
ENST00000330943; ENSP00000332062; ENSG00000167208 [Q7Z614-1]
ENST00000423026; ENSP00000388875; ENSG00000167208 [Q7Z614-4]
ENST00000568993; ENSP00000454863; ENSG00000167208 [Q7Z614-3]
GeneIDi124460
KEGGihsa:124460
UCSCiuc002egi.4 human [Q7Z614-1]

Organism-specific databases

CTDi124460
DisGeNETi124460
EuPathDBiHostDB:ENSG00000167208.14
GeneCardsiSNX20
H-InvDBiHIX0173308
HGNCiHGNC:30390 SNX20
HPAiHPA043649
MIMi613281 gene
neXtProtiNX_Q7Z614
OpenTargetsiENSG00000167208
PharmGKBiPA162404311
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IMHU Eukaryota
ENOG41114JN LUCA
GeneTreeiENSGT00530000063759
HOGENOMiHOG000154363
HOVERGENiHBG108497
InParanoidiQ7Z614
KOiK17931
OMAiCLRAGQY
OrthoDBiEOG091G0S8F
PhylomeDBiQ7Z614
TreeFamiTF326807

Miscellaneous databases

ChiTaRSiSNX20 human
GenomeRNAii124460
PROiPR:Q7Z614
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000167208 Expressed in 137 organ(s), highest expression level in blood
CleanExiHS_SNX20
ExpressionAtlasiQ7Z614 baseline and differential
GenevisibleiQ7Z614 HS

Family and domain databases

Gene3Di1.25.40.10, 1 hit
3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR001683 Phox
IPR036871 PX_dom_sf
IPR011990 TPR-like_helical_dom_sf
PfamiView protein in Pfam
PF00787 PX, 1 hit
SMARTiView protein in SMART
SM00312 PX, 1 hit
SUPFAMiSSF64268 SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50195 PX, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSNX20_HUMAN
AccessioniPrimary (citable) accession number: Q7Z614
Secondary accession number(s): A8K9D5
, Q08E98, Q6P4H2, Q8IV59
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: October 1, 2003
Last modified: September 12, 2018
This is version 121 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again