Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q7Z5L7 (PODN_HUMAN)

Entry version 148 (05 Jun 2019)
Sequence version 2 (28 Nov 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Podocan

Gene

PODN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Negatively regulates cell proliferation and cell migration.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • collagen binding Source: UniProtKB
Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Podocan
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PODN
Synonyms:SLRR5A
ORF Names:UNQ293/PRO332
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:23174 PODN

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608661 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q7Z5L7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Extracellular matrix, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		127435

Open Targets

More...OpenTargetsi		ENSG00000174348

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134980106

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PODN

Domain mapping of disease mutations (DMDM)

More...DMDMi		118573110

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Sequence analysisAdd BLAST19
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000026252420 – 613PodocanAdd BLAST594

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi214N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi281N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi299N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi410N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.2 Publications

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q7Z5L7

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q7Z5L7

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q7Z5L7

PeptideAtlas

More...PeptideAtlasi		Q7Z5L7

PRoteomics IDEntifications database

More...PRIDEi		Q7Z5L7

ProteomicsDB human proteome resource

More...ProteomicsDBi		69321
69322 [Q7Z5L7-2]
69323 [Q7Z5L7-3]
69324 [Q7Z5L7-4]

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		1618

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q7Z5L7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q7Z5L7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Kidney, heart, liver, pancreas and vascular smooth muscle cells. Also detected in aortic intima (at protein level).3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000174348 Expressed in 156 organ(s), highest expression level in esophagus

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q7Z5L7 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds to type I collagen.

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		126059, 8 interactors

Protein interaction database and analysis system

More...IntActi		Q7Z5L7, 1 interactor

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000308315

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini59 – 96LRRNTAdd BLAST38
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati97 – 118LRR 1Add BLAST22
Repeati121 – 141LRR 2Add BLAST21
Repeati147 – 168LRR 3Add BLAST22
Repeati169 – 189LRR 4Add BLAST21
Repeati192 – 212LRR 5Add BLAST21
Repeati218 – 238LRR 6Add BLAST21
Repeati239 – 260LRR 7Add BLAST22
Repeati263 – 283LRR 8Add BLAST21
Repeati289 – 310LRR 9Add BLAST22
Repeati311 – 331LRR 10Add BLAST21
Repeati334 – 357LRR 11Add BLAST24
Repeati360 – 380LRR 12Add BLAST21
Repeati381 – 402LRR 13Add BLAST22
Repeati405 – 426LRR 14Add BLAST22
Repeati431 – 452LRR 15Add BLAST22
Repeati476 – 489LRR 16Add BLAST14
Repeati502 – 522LRR 17Add BLAST21
Repeati523 – 544LRR 18Add BLAST22
Repeati547 – 568LRR 19Add BLAST22
Repeati573 – 595LRR 20Add BLAST23

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi598 – 611Glu-richAdd BLAST14

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class V subfamily.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0619 Eukaryota
COG4886 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160740

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q7Z5L7

Identification of Orthologs from Complete Genome Data

More...OMAi		QGAWMEL

Database of Orthologous Groups

More...OrthoDBi		826997at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q7Z5L7

TreeFam database of animal gene trees

More...TreeFami		TF336377

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.80.10.10, 5 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR026906 LRR_5
IPR032675 LRR_dom_sf
IPR000372 LRRNT

Pfam protein domain database

More...Pfami		View protein in Pfam
PF13306 LRR_5, 1 hit
PF13855 LRR_8, 4 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00369 LRR_TYP, 13 hits
SM00013 LRRNT, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51450 LRR, 17 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q7Z5L7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQSRVLLLL LLLPPQLHLG PVLAVRAPGF GRSGGHSLSP EENEFAEEEP 
        60         70         80         90        100
VLVLSPEEPG PGPAAVSCPR DCACSQEGVV DCGGIDLREF PGDLPEHTNH 
       110        120        130        140        150
LSLQNNQLEK IYPEELSRLH RLETLNLQNN RLTSRGLPEK AFEHLTNLNY 
       160        170        180        190        200
LYLANNKLTL APRFLPNALI SVDFAANYLT KIYGLTFGQK PNLRSVYLHN 
       210        220        230        240        250
NKLADAGLPD NMFNGSSNVE VLILSSNFLR HVPKHLPPAL YKLHLKNNKL 
       260        270        280        290        300
EKIPPGAFSE LSSLRELYLQ NNYLTDEGLD NETFWKLSSL EYLDLSSNNL 
       310        320        330        340        350
SRVPAGLPRS LVLLHLEKNA IRSVDANVLT PIRSLEYLLL HSNQLREQGI 
       360        370        380        390        400
HPLAFQGLKR LHTVHLYNNA LERVPSGLPR RVRTLMILHN QITGIGREDF 
       410        420        430        440        450
ATTYFLEELN LSYNRITSPQ VHRDAFRKLR LLRSLDLSGN RLHTLPPGLP 
       460        470        480        490        500
RNVHVLKVKR NELAALARGA LVGMAQLREL YLTSNRLRSR ALGPRAWVDL 
       510        520        530        540        550
AHLQLLDIAG NQLTEIPEGL PESLEYLYLQ NNKISAVPAN AFDSTPNLKG 
       560        570        580        590        600
IFLRFNKLAV GSVVDSAFRR LKHLQVLDIE GNLEFGDISK DRGRLGKEKE 
       610 
EEEEEEEEEE ETR
Length:613
Mass (Da):68,976
Last modified:November 28, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDA574FC77CCDAC91
GO
Isoform 2 (identifier: Q7Z5L7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGEEAEQPAWFRQPWRPGASDSAPPAGTM

Note: No signal peptide.
Show »
Length:642
Mass (Da):72,114
Checksum:i9B44460D1DB20945
GO
Isoform 3 (identifier: Q7Z5L7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGARARGAQLRLGERVRPVGRRSAPGRSRFRQPWRPGASDSAPPAGTM

Note: No signal peptide.Curated
Show »
Length:661
Mass (Da):74,142
Checksum:iA051B4E993BE82E7
GO
Isoform 4 (identifier: Q7Z5L7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGARARGAQLRLGERVRPVGRRSAPGRSRFRQPWRPGASDSAPPAGTM
     105-246: Missing.

Note: No signal peptide. No experimental confirmation available.
Show »
Length:519
Mass (Da):57,896
Checksum:iF942D35CD5BD35F1
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH28292 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 3 (identifier: Q7Z5L7-3)
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti32R → H in AAH30608 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_029497444T → M1 PublicationCorresponds to variant dbSNP:rs12567021Ensembl.1
Natural variantiVAR_029498472V → A4 PublicationsCorresponds to variant dbSNP:rs1288389Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0378271M → MEGEEAEQPAWFRQPWRPGA SDSAPPAGTM in isoform 2. 2 Publications1
Alternative sequenceiVSP_0217841M → MEGARARGAQLRLGERVRPV GRRSAPGRSRFRQPWRPGAS DSAPPAGTM in isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_039064105 – 246Missing in isoform 4. 1 PublicationAdd BLAST142

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY313607 mRNA Translation: AAP79898.1
AY358294 mRNA Translation: AAQ88661.1
AK296649 mRNA Translation: BAG59247.1
AK299375 mRNA Translation: BAG61365.1
AK304599 mRNA Translation: BAG65385.1
AL445183 Genomic DNA No translation available.
BC028292 mRNA Translation: AAH28292.1 Different initiation.
BC030608 mRNA Translation: AAH30608.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS55602.1 [Q7Z5L7-2]
CCDS573.1 [Q7Z5L7-3]

NCBI Reference Sequences

More...RefSeqi		NP_001186009.1, NM_001199080.2 [Q7Z5L7-2]
NP_001186010.1, NM_001199081.2 [Q7Z5L7-2]
NP_714914.2, NM_153703.4 [Q7Z5L7-3]
XP_005270514.1, XM_005270457.3 [Q7Z5L7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000312553; ENSP00000308315; ENSG00000174348 [Q7Z5L7-3]
ENST00000371500; ENSP00000360555; ENSG00000174348 [Q7Z5L7-2]
ENST00000395871; ENSP00000379212; ENSG00000174348 [Q7Z5L7-4]
ENST00000618387; ENSP00000479233; ENSG00000174348 [Q7Z5L7-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		127435

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:127435

UCSC genome browser

More...UCSCi		uc001cuv.4 human [Q7Z5L7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY313607 mRNA Translation: AAP79898.1
AY358294 mRNA Translation: AAQ88661.1
AK296649 mRNA Translation: BAG59247.1
AK299375 mRNA Translation: BAG61365.1
AK304599 mRNA Translation: BAG65385.1
AL445183 Genomic DNA No translation available.
BC028292 mRNA Translation: AAH28292.1 Different initiation.
BC030608 mRNA Translation: AAH30608.1
CCDSiCCDS55602.1 [Q7Z5L7-2]
CCDS573.1 [Q7Z5L7-3]
RefSeqiNP_001186009.1, NM_001199080.2 [Q7Z5L7-2]
NP_001186010.1, NM_001199081.2 [Q7Z5L7-2]
NP_714914.2, NM_153703.4 [Q7Z5L7-3]
XP_005270514.1, XM_005270457.3 [Q7Z5L7-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGridi126059, 8 interactors
IntActiQ7Z5L7, 1 interactor
STRINGi9606.ENSP00000308315

PTM databases

GlyConnecti1618
iPTMnetiQ7Z5L7
PhosphoSitePlusiQ7Z5L7

Polymorphism and mutation databases

BioMutaiPODN
DMDMi118573110

Proteomic databases

EPDiQ7Z5L7
jPOSTiQ7Z5L7
PaxDbiQ7Z5L7
PeptideAtlasiQ7Z5L7
PRIDEiQ7Z5L7
ProteomicsDBi69321
69322 [Q7Z5L7-2]
69323 [Q7Z5L7-3]
69324 [Q7Z5L7-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		127435
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000312553; ENSP00000308315; ENSG00000174348 [Q7Z5L7-3]
ENST00000371500; ENSP00000360555; ENSG00000174348 [Q7Z5L7-2]
ENST00000395871; ENSP00000379212; ENSG00000174348 [Q7Z5L7-4]
ENST00000618387; ENSP00000479233; ENSG00000174348 [Q7Z5L7-2]
GeneIDi127435
KEGGihsa:127435
UCSCiuc001cuv.4 human [Q7Z5L7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		127435
DisGeNETi127435

GeneCards: human genes, protein and diseases

More...GeneCardsi		PODN

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0199924
HGNCiHGNC:23174 PODN
MIMi608661 gene
neXtProtiNX_Q7Z5L7
OpenTargetsiENSG00000174348
PharmGKBiPA134980106

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0619 Eukaryota
COG4886 LUCA
GeneTreeiENSGT00940000160740
InParanoidiQ7Z5L7
OMAiQGAWMEL
OrthoDBi826997at2759
PhylomeDBiQ7Z5L7
TreeFamiTF336377

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PODN human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		127435

Protein Ontology

More...PROi		PR:Q7Z5L7

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000174348 Expressed in 156 organ(s), highest expression level in esophagus
GenevisibleiQ7Z5L7 HS

Family and domain databases

Gene3Di3.80.10.10, 5 hits
InterProiView protein in InterPro
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR026906 LRR_5
IPR032675 LRR_dom_sf
IPR000372 LRRNT
PfamiView protein in Pfam
PF13306 LRR_5, 1 hit
PF13855 LRR_8, 4 hits
SMARTiView protein in SMART
SM00369 LRR_TYP, 13 hits
SM00013 LRRNT, 1 hit
PROSITEiView protein in PROSITE
PS51450 LRR, 17 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPODN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7Z5L7
Secondary accession number(s): B4DKN5
, B4E373, Q5VVZ2, Q5VVZ3, Q6PIR3, Q6UXL8, Q8N641
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: November 28, 2006
Last modified: June 5, 2019
This is version 148 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again