Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Wings apart-like protein homolog

Gene

WAPL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulator of sister chromatid cohesion in mitosis which negatively regulates cohesin association with chromatin. Involved in both sister chromatid cohesion during interphase and sister-chromatid resolution during early stages of mitosis. Couples DNA replication to sister chromatid cohesion. Cohesion ensures that chromosome partitioning is accurate in both meiotic and mitotic cells and plays an important role in DNA repair.7 Publications

GO - Biological processi

Keywordsi

Biological processCell cycle, Cell division, Host-virus interaction, Mitosis

Enzyme and pathway databases

ReactomeiR-HSA-2467813 Separation of Sister Chromatids
R-HSA-2468052 Establishment of Sister Chromatid Cohesion
R-HSA-2470946 Cohesin Loading onto Chromatin
R-HSA-2500257 Resolution of Sister Chromatid Cohesion

Names & Taxonomyi

Protein namesi
Recommended name:
Wings apart-like protein homolog
Alternative name(s):
Friend of EBNA2 protein
WAPL cohesin release factorImported
Gene namesi
Name:WAPLImported
Synonyms:FOE, KIAA0261, WAPAL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000062650.17
HGNCiHGNC:23293 WAPL
MIMi610754 gene
neXtProtiNX_Q7Z5K2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi73 – 75FGF → EGE: Loss of interaction with PDS5B; when associated with 429-E--E-431 and 453-E--E-455. 1 Publication3
Mutagenesisi429 – 431FGF → EGE: Loss of interaction with PDS5B; when associated with 73-E--E-75 and 453-E--E-455. 1 Publication3
Mutagenesisi453 – 455FGF → EGE: Loss of interaction with PDS5B; when associated with 73-E--E-75 and 429-E--E-431. 1 Publication3
Mutagenesisi639 – 640VK → AE: Impaired sister chromatid cohesion and resolution. 1 Publication2
Mutagenesisi656 – 657DD → KK: Impaired sister chromatid cohesion and resolution. 1 Publication2
Mutagenesisi770E → K: No effect. 1 Publication1
Mutagenesisi777E → K: No effect. 1 Publication1
Mutagenesisi787E → K: No effect. 1 Publication1
Mutagenesisi790T → A: No effect. 1 Publication1
Mutagenesisi1116M → A: Impaired sister chromatid cohesion and resolution; when associated with A-1120. 1 Publication1
Mutagenesisi1120I → A: Impaired sister chromatid cohesion and resolution; when associated with A-1116. 1 Publication1

Organism-specific databases

DisGeNETi23063
OpenTargetsiENSG00000062650
PharmGKBiPA134872402

Polymorphism and mutation databases

BioMutaiWAPAL
DMDMi74713658

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002452321 – 1190Wings apart-like protein homologAdd BLAST1190

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei77PhosphoserineCombined sources1
Modified residuei168N6-acetyllysineCombined sources1
Modified residuei221PhosphoserineCombined sources1
Modified residuei223PhosphoserineCombined sources1
Modified residuei226PhosphoserineCombined sources1
Modified residuei347PhosphoserineCombined sources1
Modified residuei380PhosphoserineCombined sources1
Modified residuei443PhosphoserineCombined sources1
Modified residuei459PhosphoserineCombined sources1
Modified residuei461PhosphoserineCombined sources1
Modified residuei904PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ7Z5K2
MaxQBiQ7Z5K2
PaxDbiQ7Z5K2
PeptideAtlasiQ7Z5K2
PRIDEiQ7Z5K2
ProteomicsDBi69311
69312 [Q7Z5K2-2]
69313 [Q7Z5K2-3]

PTM databases

iPTMnetiQ7Z5K2
PhosphoSitePlusiQ7Z5K2

Expressioni

Tissue specificityi

Isoform 1 is highly expressed in uterine cervix tumor. Isoform 2 is widely expressed with a high level in skeletal muscle and heart.2 Publications

Gene expression databases

BgeeiENSG00000062650 Expressed in 232 organ(s), highest expression level in secondary oocyte
CleanExiHS_WAPAL
ExpressionAtlasiQ7Z5K2 baseline and differential
GenevisibleiQ7Z5K2 HS

Organism-specific databases

HPAiHPA037874
HPA037875

Interactioni

Subunit structurei

Interacts with the cohesin complex throughout the cell cycle; interacts with both chromatin-bound and soluble pools of the complex. Interacts with RAD21; the interaction is direct. Interacts with PDS5A; the interaction is direct, cohesin-dependent and competitive with CDCA5/SORORIN. Interacts (via FGF motifs) with PDS5B; the interaction is direct. Interacts with a SMC1 protein (SMC1A or SMC1B) and SMC3.6 Publications
(Microbial infection) Isoform 2 interacts with Epstein-Barr virus EBNA2.1 Publication

Binary interactionsi

Protein-protein interaction databases

BioGridi116698, 65 interactors
DIPiDIP-31176N
IntActiQ7Z5K2, 34 interactors
MINTiQ7Z5K2
STRINGi9606.ENSP00000298767

Structurei

Secondary structure

11190
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ7Z5K2
SMRiQ7Z5K2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini626 – 1169WAPLPROSITE-ProRule annotationAdd BLAST544

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 659Mediates interaction with the cohesin complexAdd BLAST659

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili260 – 286Sequence analysisAdd BLAST27
Coiled coili749 – 782Sequence analysisAdd BLAST34

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi73 – 75FGF motif 13
Motifi429 – 431FGF motif 23
Motifi453 – 455FGF motif 33

Sequence similaritiesi

Belongs to the WAPL family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG2152 Eukaryota
ENOG410XSDS LUCA
GeneTreeiENSGT00390000015768
HOGENOMiHOG000001563
HOVERGENiHBG088338
InParanoidiQ7Z5K2
OMAiVKMTSRF
OrthoDBiEOG091G042I
PhylomeDBiQ7Z5K2
TreeFamiTF323477

Family and domain databases

Gene3Di1.25.10.10, 2 hits
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR039874 WAPL
IPR022771 WAPL_C
IPR012502 WAPL_dom
PANTHERiPTHR22100 PTHR22100, 1 hit
PfamiView protein in Pfam
PF07814 WAPL, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51271 WAPL, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z5K2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSRFGKTYS RKGGNGSSKF DEVFSNKRTT LSTKWGETTF MAKLGQKRPN
60 70 80 90 100
FKPDIQEIPK KPKVEEESTG DPFGFDSDDE SLPVSSKNLA QVKCSSYSES
110 120 130 140 150
SEAAQLEEVT SVLEANSKIS HVVVEDTVVS DKCFPLEDTL LGKEKSTNRI
160 170 180 190 200
VEDDASISSC NKLITSDKVE NFHEEHEKNS HHIHKNADDS TKKPNAETTV
210 220 230 240 250
ASEIKETNDT WNSQFGKRPE SPSEISPIKG SVRTGLFEWD NDFEDIRSED
260 270 280 290 300
CILSLDSDPL LEMKDDDFKN RLENLNEAIE EDIVQSVLRP TNCRTYCRAN
310 320 330 340 350
KTKSSQGASN FDKLMDGTSQ ALAKANSESS KDGLNQAKKG GVSCGTSFRG
360 370 380 390 400
TVGRTRDYTV LHPSCLSVCN VTIQDTMERS MDEFTASTPA DLGEAGRLRK
410 420 430 440 450
KADIATSKTT TRFRPSNTKS KKDVKLEFFG FEDHETGGDE GGSGSSNYKI
460 470 480 490 500
KYFGFDDLSE SEDDEDDDCQ VERKTSKKRT KTAPSPSLQP PPESNDNSQD
510 520 530 540 550
SQSGTNNAEN LDFTEDLPGV PESVKKPINK QGDKSKENTR KIFSGPKRSP
560 570 580 590 600
TKAVYNARHW NHPDSEELPG PPVVKPQSVT VRLSSKEPNQ KDDGVFKAPA
610 620 630 640 650
PPSKVIKTVT IPTQPYQDIV TALKCRREDK ELYTVVQHVK HFNDVVEFGE
660 670 680 690 700
NQEFTDDIEY LLSGLKSTQP LNTRCLSVIS LATKCAMPSF RMHLRAHGMV
710 720 730 740 750
AMVFKTLDDS QHHQNLSLCT AALMYILSRD RLNMDLDRAS LDLMIRLLEL
760 770 780 790 800
EQDASSAKLL NEKDMNKIKE KIRRLCETVH NKHLDLENIT TGHLAMETLL
810 820 830 840 850
SLTSKRAGDW FKEELRLLGG LDHIVDKVKE CVDHLSRDED EEKLVASLWG
860 870 880 890 900
AERCLRVLES VTVHNPENQS YLIAYKDSQL IVSSAKALQH CEELIQQYNR
910 920 930 940 950
AEDSICLADS KPLPHQNVTN HVGKAVEDCM RAIIGVLLNL TNDNEWGSTK
960 970 980 990 1000
TGEQDGLIGT ALNCVLQVPK YLPQEQRFDI RVLGLGLLIN LVEYSARNRH
1010 1020 1030 1040 1050
CLVNMETSCS FDSSICSGEG DDSLRIGGQV HAVQALVQLF LERERAAQLA
1060 1070 1080 1090 1100
ESKTDELIKD APTTQHDKSG EWQETSGEIQ WVSTEKTDGT EEKHKKEEED
1110 1120 1130 1140 1150
EELDLNKALQ HAGKHMEDCI VASYTALLLG CLCQESPINV TTVREYLPEG
1160 1170 1180 1190
DFSIMTEMLK KFLSFMNLTC AVGTTGQKSI SRVIEYLEHC
Length:1,190
Mass (Da):132,946
Last modified:October 1, 2003 - v1
Checksum:iA01026E520BFAB2F
GO
Isoform 2 (identifier: Q7Z5K2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVQGPVQTPALTIHRRKRRRRRRRRPVAKAPARLRGEYETGVKM
     510-515: Missing.

Note: No experimental confirmation available.
Show »
Length:1,227
Mass (Da):137,314
Checksum:i5431910072375C05
GO
Isoform 3 (identifier: Q7Z5K2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVQGPVQTPA...RGEYETGVKM

Note: No experimental confirmation available.
Show »
Length:1,275
Mass (Da):142,525
Checksum:i5588D17DBB5C782F
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q8WVX6Q8WVX6_HUMAN
WAPAL protein
WAPL WAPAL
402Annotation score:
F6QZY1F6QZY1_HUMAN
Wings apart-like protein homolog
WAPL
421Annotation score:

Sequence cautioni

The sequence BAA13391 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_026967124V → I. Corresponds to variant dbSNP:rs10887621Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0196491M → MVQGPVQTPALTIHRRKRRR RRRRRPVAKAPARLRGEYET GVKM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0196501M → MVQGPVQTPALTIHRRKRRR SCPPNRASYLPKAESLASLG SHLPALLSRARVPRPPAGRR ERERRRRPVAKAPARLRGEY ETGVKM in isoform 3. 1 Publication1
Alternative sequenceiVSP_019651510 – 515Missing in isoform 2. 1 Publication6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB065003 mRNA Translation: BAC78631.1
AF479418 mRNA Translation: AAO14651.1
D87450 mRNA Translation: BAA13391.1 Different initiation.
AL731569 Genomic DNA No translation available.
AL844892 Genomic DNA No translation available.
CH471142 Genomic DNA Translation: EAW80336.1
BC150269 mRNA Translation: AAI50270.1
CCDSiCCDS7375.1 [Q7Z5K2-1]
RefSeqiNP_001305257.1, NM_001318328.1
NP_055860.1, NM_015045.3 [Q7Z5K2-1]
UniGeneiHs.203099
Hs.714876

Genome annotation databases

EnsembliENST00000298767; ENSP00000298767; ENSG00000062650 [Q7Z5K2-1]
ENST00000618527; ENSP00000481451; ENSG00000062650 [Q7Z5K2-1]
GeneIDi23063
KEGGihsa:23063
UCSCiuc001kdo.4 human [Q7Z5K2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB065003 mRNA Translation: BAC78631.1
AF479418 mRNA Translation: AAO14651.1
D87450 mRNA Translation: BAA13391.1 Different initiation.
AL731569 Genomic DNA No translation available.
AL844892 Genomic DNA No translation available.
CH471142 Genomic DNA Translation: EAW80336.1
BC150269 mRNA Translation: AAI50270.1
CCDSiCCDS7375.1 [Q7Z5K2-1]
RefSeqiNP_001305257.1, NM_001318328.1
NP_055860.1, NM_015045.3 [Q7Z5K2-1]
UniGeneiHs.203099
Hs.714876

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4K6JX-ray2.62A/B631-1190[»]
5HDTX-ray2.71E1-33[»]
ProteinModelPortaliQ7Z5K2
SMRiQ7Z5K2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116698, 65 interactors
DIPiDIP-31176N
IntActiQ7Z5K2, 34 interactors
MINTiQ7Z5K2
STRINGi9606.ENSP00000298767

PTM databases

iPTMnetiQ7Z5K2
PhosphoSitePlusiQ7Z5K2

Polymorphism and mutation databases

BioMutaiWAPAL
DMDMi74713658

Proteomic databases

EPDiQ7Z5K2
MaxQBiQ7Z5K2
PaxDbiQ7Z5K2
PeptideAtlasiQ7Z5K2
PRIDEiQ7Z5K2
ProteomicsDBi69311
69312 [Q7Z5K2-2]
69313 [Q7Z5K2-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000298767; ENSP00000298767; ENSG00000062650 [Q7Z5K2-1]
ENST00000618527; ENSP00000481451; ENSG00000062650 [Q7Z5K2-1]
GeneIDi23063
KEGGihsa:23063
UCSCiuc001kdo.4 human [Q7Z5K2-1]

Organism-specific databases

CTDi23063
DisGeNETi23063
EuPathDBiHostDB:ENSG00000062650.17
GeneCardsiWAPL
HGNCiHGNC:23293 WAPL
HPAiHPA037874
HPA037875
MIMi610754 gene
neXtProtiNX_Q7Z5K2
OpenTargetsiENSG00000062650
PharmGKBiPA134872402
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2152 Eukaryota
ENOG410XSDS LUCA
GeneTreeiENSGT00390000015768
HOGENOMiHOG000001563
HOVERGENiHBG088338
InParanoidiQ7Z5K2
OMAiVKMTSRF
OrthoDBiEOG091G042I
PhylomeDBiQ7Z5K2
TreeFamiTF323477

Enzyme and pathway databases

ReactomeiR-HSA-2467813 Separation of Sister Chromatids
R-HSA-2468052 Establishment of Sister Chromatid Cohesion
R-HSA-2470946 Cohesin Loading onto Chromatin
R-HSA-2500257 Resolution of Sister Chromatid Cohesion

Miscellaneous databases

ChiTaRSiWAPL human
GeneWikiiWAPAL
GenomeRNAii23063
PROiPR:Q7Z5K2
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000062650 Expressed in 232 organ(s), highest expression level in secondary oocyte
CleanExiHS_WAPAL
ExpressionAtlasiQ7Z5K2 baseline and differential
GenevisibleiQ7Z5K2 HS

Family and domain databases

Gene3Di1.25.10.10, 2 hits
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR039874 WAPL
IPR022771 WAPL_C
IPR012502 WAPL_dom
PANTHERiPTHR22100 PTHR22100, 1 hit
PfamiView protein in Pfam
PF07814 WAPL, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51271 WAPL, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiWAPL_HUMAN
AccessioniPrimary (citable) accession number: Q7Z5K2
Secondary accession number(s): A7E2B5
, Q5VSK5, Q8IX10, Q92549
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: October 1, 2003
Last modified: November 7, 2018
This is version 128 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again