Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 131 (13 Feb 2019)
Sequence version 1 (01 Oct 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Wings apart-like protein homolog

Gene

WAPL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulator of sister chromatid cohesion in mitosis which negatively regulates cohesin association with chromatin. Involved in both sister chromatid cohesion during interphase and sister-chromatid resolution during early stages of mitosis. Couples DNA replication to sister chromatid cohesion. Cohesion ensures that chromosome partitioning is accurate in both meiotic and mitotic cells and plays an important role in DNA repair.7 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Host-virus interaction, Mitosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2468052 Establishment of Sister Chromatid Cohesion
R-HSA-2470946 Cohesin Loading onto Chromatin
R-HSA-2500257 Resolution of Sister Chromatid Cohesion

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Wings apart-like protein homolog
Alternative name(s):
Friend of EBNA2 protein
WAPL cohesin release factorImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:WAPLImported
Synonyms:FOE, KIAA0261, WAPAL
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000062650.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23293 WAPL

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610754 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7Z5K2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi73 – 75FGF → EGE: Loss of interaction with PDS5B; when associated with 429-E--E-431 and 453-E--E-455. 1 Publication3
Mutagenesisi429 – 431FGF → EGE: Loss of interaction with PDS5B; when associated with 73-E--E-75 and 453-E--E-455. 1 Publication3
Mutagenesisi453 – 455FGF → EGE: Loss of interaction with PDS5B; when associated with 73-E--E-75 and 429-E--E-431. 1 Publication3
Mutagenesisi639 – 640VK → AE: Impaired sister chromatid cohesion and resolution. 1 Publication2
Mutagenesisi656 – 657DD → KK: Impaired sister chromatid cohesion and resolution. 1 Publication2
Mutagenesisi770E → K: No effect. 1 Publication1
Mutagenesisi777E → K: No effect. 1 Publication1
Mutagenesisi787E → K: No effect. 1 Publication1
Mutagenesisi790T → A: No effect. 1 Publication1
Mutagenesisi1116M → A: Impaired sister chromatid cohesion and resolution; when associated with A-1120. 1 Publication1
Mutagenesisi1120I → A: Impaired sister chromatid cohesion and resolution; when associated with A-1116. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
23063

Open Targets

More...
OpenTargetsi
ENSG00000062650

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134872402

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
WAPL

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74713658

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002452321 – 1190Wings apart-like protein homologAdd BLAST1190

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei77PhosphoserineCombined sources1
Modified residuei168N6-acetyllysineCombined sources1
Modified residuei221PhosphoserineCombined sources1
Modified residuei223PhosphoserineCombined sources1
Modified residuei226PhosphoserineCombined sources1
Modified residuei347PhosphoserineCombined sources1
Modified residuei380PhosphoserineCombined sources1
Modified residuei443PhosphoserineCombined sources1
Modified residuei459PhosphoserineCombined sources1
Modified residuei461PhosphoserineCombined sources1
Modified residuei904PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7Z5K2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q7Z5K2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q7Z5K2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7Z5K2

PeptideAtlas

More...
PeptideAtlasi
Q7Z5K2

PRoteomics IDEntifications database

More...
PRIDEi
Q7Z5K2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
69311
69312 [Q7Z5K2-2]
69313 [Q7Z5K2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7Z5K2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7Z5K2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is highly expressed in uterine cervix tumor. Isoform 2 is widely expressed with a high level in skeletal muscle and heart.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000062650 Expressed in 232 organ(s), highest expression level in secondary oocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7Z5K2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7Z5K2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA037874
HPA037875

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the cohesin complex throughout the cell cycle; interacts with both chromatin-bound and soluble pools of the complex. Interacts with RAD21; the interaction is direct. Interacts with PDS5A; the interaction is direct, cohesin-dependent and competitive with CDCA5/SORORIN. Interacts (via FGF motifs) with PDS5B; the interaction is direct. Interacts with a SMC1 protein (SMC1A or SMC1B) and SMC3.6 Publications
(Microbial infection) Isoform 2 interacts with Epstein-Barr virus EBNA2.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116698, 66 interactors

Database of interacting proteins

More...
DIPi
DIP-31176N

Protein interaction database and analysis system

More...
IntActi
Q7Z5K2, 35 interactors

Molecular INTeraction database

More...
MINTi
Q7Z5K2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000298767

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11190
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4K6JX-ray2.62A/B631-1190[»]
5HDTX-ray2.71E1-33[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q7Z5K2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7Z5K2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini626 – 1169WAPLPROSITE-ProRule annotationAdd BLAST544

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 659Mediates interaction with the cohesin complexAdd BLAST659

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili260 – 286Sequence analysisAdd BLAST27
Coiled coili749 – 782Sequence analysisAdd BLAST34

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi73 – 75FGF motif 13
Motifi429 – 431FGF motif 23
Motifi453 – 455FGF motif 33

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WAPL family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2152 Eukaryota
ENOG410XSDS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000015768

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000001563

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG088338

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7Z5K2

Identification of Orthologs from Complete Genome Data

More...
OMAi
VKMTSRF

Database of Orthologous Groups

More...
OrthoDBi
81845at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7Z5K2

TreeFam database of animal gene trees

More...
TreeFami
TF323477

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR039874 WAPL
IPR022771 WAPL_C
IPR012502 WAPL_dom

The PANTHER Classification System

More...
PANTHERi
PTHR22100 PTHR22100, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07814 WAPL, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51271 WAPL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z5K2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSRFGKTYS RKGGNGSSKF DEVFSNKRTT LSTKWGETTF MAKLGQKRPN
60 70 80 90 100
FKPDIQEIPK KPKVEEESTG DPFGFDSDDE SLPVSSKNLA QVKCSSYSES
110 120 130 140 150
SEAAQLEEVT SVLEANSKIS HVVVEDTVVS DKCFPLEDTL LGKEKSTNRI
160 170 180 190 200
VEDDASISSC NKLITSDKVE NFHEEHEKNS HHIHKNADDS TKKPNAETTV
210 220 230 240 250
ASEIKETNDT WNSQFGKRPE SPSEISPIKG SVRTGLFEWD NDFEDIRSED
260 270 280 290 300
CILSLDSDPL LEMKDDDFKN RLENLNEAIE EDIVQSVLRP TNCRTYCRAN
310 320 330 340 350
KTKSSQGASN FDKLMDGTSQ ALAKANSESS KDGLNQAKKG GVSCGTSFRG
360 370 380 390 400
TVGRTRDYTV LHPSCLSVCN VTIQDTMERS MDEFTASTPA DLGEAGRLRK
410 420 430 440 450
KADIATSKTT TRFRPSNTKS KKDVKLEFFG FEDHETGGDE GGSGSSNYKI
460 470 480 490 500
KYFGFDDLSE SEDDEDDDCQ VERKTSKKRT KTAPSPSLQP PPESNDNSQD
510 520 530 540 550
SQSGTNNAEN LDFTEDLPGV PESVKKPINK QGDKSKENTR KIFSGPKRSP
560 570 580 590 600
TKAVYNARHW NHPDSEELPG PPVVKPQSVT VRLSSKEPNQ KDDGVFKAPA
610 620 630 640 650
PPSKVIKTVT IPTQPYQDIV TALKCRREDK ELYTVVQHVK HFNDVVEFGE
660 670 680 690 700
NQEFTDDIEY LLSGLKSTQP LNTRCLSVIS LATKCAMPSF RMHLRAHGMV
710 720 730 740 750
AMVFKTLDDS QHHQNLSLCT AALMYILSRD RLNMDLDRAS LDLMIRLLEL
760 770 780 790 800
EQDASSAKLL NEKDMNKIKE KIRRLCETVH NKHLDLENIT TGHLAMETLL
810 820 830 840 850
SLTSKRAGDW FKEELRLLGG LDHIVDKVKE CVDHLSRDED EEKLVASLWG
860 870 880 890 900
AERCLRVLES VTVHNPENQS YLIAYKDSQL IVSSAKALQH CEELIQQYNR
910 920 930 940 950
AEDSICLADS KPLPHQNVTN HVGKAVEDCM RAIIGVLLNL TNDNEWGSTK
960 970 980 990 1000
TGEQDGLIGT ALNCVLQVPK YLPQEQRFDI RVLGLGLLIN LVEYSARNRH
1010 1020 1030 1040 1050
CLVNMETSCS FDSSICSGEG DDSLRIGGQV HAVQALVQLF LERERAAQLA
1060 1070 1080 1090 1100
ESKTDELIKD APTTQHDKSG EWQETSGEIQ WVSTEKTDGT EEKHKKEEED
1110 1120 1130 1140 1150
EELDLNKALQ HAGKHMEDCI VASYTALLLG CLCQESPINV TTVREYLPEG
1160 1170 1180 1190
DFSIMTEMLK KFLSFMNLTC AVGTTGQKSI SRVIEYLEHC
Length:1,190
Mass (Da):132,946
Last modified:October 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA01026E520BFAB2F
GO
Isoform 2 (identifier: Q7Z5K2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVQGPVQTPALTIHRRKRRRRRRRRPVAKAPARLRGEYETGVKM
     510-515: Missing.

Note: No experimental confirmation available.
Show »
Length:1,227
Mass (Da):137,314
Checksum:i5431910072375C05
GO
Isoform 3 (identifier: Q7Z5K2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVQGPVQTPA...RGEYETGVKM

Note: No experimental confirmation available.
Show »
Length:1,275
Mass (Da):142,525
Checksum:i5588D17DBB5C782F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q8WVX6Q8WVX6_HUMAN
WAPAL protein
WAPL WAPAL
402Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6QZY1F6QZY1_HUMAN
Wings apart-like protein homolog
WAPL
421Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA13391 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_026967124V → I. Corresponds to variant dbSNP:rs10887621Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0196491M → MVQGPVQTPALTIHRRKRRR RRRRRPVAKAPARLRGEYET GVKM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0196501M → MVQGPVQTPALTIHRRKRRR SCPPNRASYLPKAESLASLG SHLPALLSRARVPRPPAGRR ERERRRRPVAKAPARLRGEY ETGVKM in isoform 3. 1 Publication1
Alternative sequenceiVSP_019651510 – 515Missing in isoform 2. 1 Publication6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB065003 mRNA Translation: BAC78631.1
AF479418 mRNA Translation: AAO14651.1
D87450 mRNA Translation: BAA13391.1 Different initiation.
AL731569 Genomic DNA No translation available.
AL844892 Genomic DNA No translation available.
CH471142 Genomic DNA Translation: EAW80336.1
BC150269 mRNA Translation: AAI50270.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7375.1 [Q7Z5K2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001305257.1, NM_001318328.1
NP_055860.1, NM_015045.3 [Q7Z5K2-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.203099
Hs.714876

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000298767; ENSP00000298767; ENSG00000062650 [Q7Z5K2-1]
ENST00000618527; ENSP00000481451; ENSG00000062650 [Q7Z5K2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23063

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23063

UCSC genome browser

More...
UCSCi
uc001kdo.4 human [Q7Z5K2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB065003 mRNA Translation: BAC78631.1
AF479418 mRNA Translation: AAO14651.1
D87450 mRNA Translation: BAA13391.1 Different initiation.
AL731569 Genomic DNA No translation available.
AL844892 Genomic DNA No translation available.
CH471142 Genomic DNA Translation: EAW80336.1
BC150269 mRNA Translation: AAI50270.1
CCDSiCCDS7375.1 [Q7Z5K2-1]
RefSeqiNP_001305257.1, NM_001318328.1
NP_055860.1, NM_015045.3 [Q7Z5K2-1]
UniGeneiHs.203099
Hs.714876

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4K6JX-ray2.62A/B631-1190[»]
5HDTX-ray2.71E1-33[»]
ProteinModelPortaliQ7Z5K2
SMRiQ7Z5K2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116698, 66 interactors
DIPiDIP-31176N
IntActiQ7Z5K2, 35 interactors
MINTiQ7Z5K2
STRINGi9606.ENSP00000298767

PTM databases

iPTMnetiQ7Z5K2
PhosphoSitePlusiQ7Z5K2

Polymorphism and mutation databases

BioMutaiWAPL
DMDMi74713658

Proteomic databases

EPDiQ7Z5K2
jPOSTiQ7Z5K2
MaxQBiQ7Z5K2
PaxDbiQ7Z5K2
PeptideAtlasiQ7Z5K2
PRIDEiQ7Z5K2
ProteomicsDBi69311
69312 [Q7Z5K2-2]
69313 [Q7Z5K2-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000298767; ENSP00000298767; ENSG00000062650 [Q7Z5K2-1]
ENST00000618527; ENSP00000481451; ENSG00000062650 [Q7Z5K2-1]
GeneIDi23063
KEGGihsa:23063
UCSCiuc001kdo.4 human [Q7Z5K2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23063
DisGeNETi23063
EuPathDBiHostDB:ENSG00000062650.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
WAPL
HGNCiHGNC:23293 WAPL
HPAiHPA037874
HPA037875
MIMi610754 gene
neXtProtiNX_Q7Z5K2
OpenTargetsiENSG00000062650
PharmGKBiPA134872402

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2152 Eukaryota
ENOG410XSDS LUCA
GeneTreeiENSGT00390000015768
HOGENOMiHOG000001563
HOVERGENiHBG088338
InParanoidiQ7Z5K2
OMAiVKMTSRF
OrthoDBi81845at2759
PhylomeDBiQ7Z5K2
TreeFamiTF323477

Enzyme and pathway databases

ReactomeiR-HSA-2467813 Separation of Sister Chromatids
R-HSA-2468052 Establishment of Sister Chromatid Cohesion
R-HSA-2470946 Cohesin Loading onto Chromatin
R-HSA-2500257 Resolution of Sister Chromatid Cohesion

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
WAPL human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
WAPAL

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23063

Protein Ontology

More...
PROi
PR:Q7Z5K2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000062650 Expressed in 232 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiQ7Z5K2 baseline and differential
GenevisibleiQ7Z5K2 HS

Family and domain databases

Gene3Di1.25.10.10, 2 hits
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR039874 WAPL
IPR022771 WAPL_C
IPR012502 WAPL_dom
PANTHERiPTHR22100 PTHR22100, 1 hit
PfamiView protein in Pfam
PF07814 WAPL, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51271 WAPL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWAPL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7Z5K2
Secondary accession number(s): A7E2B5
, Q5VSK5, Q8IX10, Q92549
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: October 1, 2003
Last modified: February 13, 2019
This is version 131 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again