Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 112 (16 Oct 2019)
Sequence version 2 (02 Sep 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Chemokine-like protein TAFA-5

Gene

TAFA5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a chemokine-like protein by regulating cell proliferation and migration through activation of G protein-coupled receptors (GPCRs), such as S1PR2 and FPR2 (By similarity). Stimulates chemotactic migration of macrophages mediated by the MAPK3/ERK1 and AKT1 pathway (By similarity). Blocks TNFSF11/RANKL-induced osteoclast formation from macrophages by inhibiting up-regulation of osteoclast fusogenic and differentiation genes (By similarity). Stimulation of macrophage migration and inhibition of osteoclast formation is mediated via GPCR FPR2 (By similarity). Acts as an adipokine by negatively regulating vascular smooth muscle cell (VSMC) proliferation and migration in response to platelet-derived growth factor stimulation via GPCR S1PR2 and G protein GNA12/GNA13-transmitted RHOA signaling (By similarity). Inhibits injury-induced cell proliferation and neointima formation in the femoral arteries (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCytokine

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Chemokine-like protein TAFA-5Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TAFA5Imported
Synonyms:FAM19A5Imported
ORF Names:UNQ5208/PRO34524
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21592 TAFA5

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617499 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7Z5A7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
25817

Open Targets

More...
OpenTargetsi
ENSG00000219438

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134887312

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q7Z5A7

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FAM19A5

Domain mapping of disease mutations (DMDM)

More...
DMDMi
205371754

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 431 PublicationAdd BLAST43
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000004273244 – 132Chemokine-like protein TAFA-51 PublicationAdd BLAST89

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi113N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1

Keywords - PTMi

Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q7Z5A7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7Z5A7

PeptideAtlas

More...
PeptideAtlasi
Q7Z5A7

PRoteomics IDEntifications database

More...
PRIDEi
Q7Z5A7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
69275 [Q7Z5A7-1]
69276 [Q7Z5A7-2]
69277 [Q7Z5A7-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7Z5A7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7Z5A7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the subcutaneous and perirenal adipose tissue (at protein level) (PubMed:29453251). Highly expressed in adipose tissue with moderate expression in the brain and ovary (PubMed:29453251). Isoform 2: Brain-specific (PubMed:15028294).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000219438 Expressed in 151 organ(s), highest expression level in tibial nerve

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7Z5A7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7Z5A7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB025629

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117345, 18 interactors

Protein interaction database and analysis system

More...
IntActi
Q7Z5A7, 1 interactor

Molecular INTeraction database

More...
MINTi
Q7Z5A7

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000383933

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TAFA family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IZKE Eukaryota
ENOG410YTJG LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160682

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7Z5A7

Identification of Orthologs from Complete Genome Data

More...
OMAi
PRMSSTF

Database of Orthologous Groups

More...
OrthoDBi
1417753at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7Z5A7

TreeFam database of animal gene trees

More...
TreeFami
TF331749

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020350 Chemokine-like_TAFA
IPR040329 TAFA-5

The PANTHER Classification System

More...
PANTHERi
PTHR31878 PTHR31878, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12020 TAFA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z5A7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPSPRTGSR QDATALPSMS STFWAFMILA SLLIAYCSQL AAGTCEIVTL
60 70 80 90 100
DRDSSQPRRT IARQTARCAC RKGQIAGTTR ARPACVDARI IKTKQWCDML
110 120 130
PCLEGEGCDL LINRSGWTCT QPGGRIKTTT VS
Length:132
Mass (Da):14,301
Last modified:September 2, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i16BFE9F574FBB066
GO
Isoform 2 (identifier: Q7Z5A7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCS → MQLLKALWALAGAALCCFLVLVIHAQFLKEG

Note: Contains a predicted signal peptide at positions 1-25.Curated
Show »
Length:125
Mass (Da):13,592
Checksum:iA8BCA8D09F86404A
GO
Isoform 3 (identifier: Q7Z5A7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-87: MAPSPRTGSR...TTRARPACVD → MYHHREWP

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:53
Mass (Da):6,119
Checksum:iBE4717D812247D1D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1B1J6B1B1J6_HUMAN
Chemokine-like protein TAFA-5
TAFA5
181Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD20061 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAH39396 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q7Z5A7-2)
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti11 – 23AGAAL…LVLVI → V in AAQ89206 (PubMed:12975309).CuratedAdd BLAST13

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0351911 – 87MAPSP…PACVD → MYHHREWP in isoform 3. CuratedAdd BLAST87
Alternative sequenceiVSP_0160681 – 38MAPSP…IAYCS → MQLLKALWALAGAALCCFLV LVIHAQFLKEG in isoform 2. 3 PublicationsAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY325118 mRNA Translation: AAP92410.1
AF131851 mRNA Translation: AAD20061.1 Different initiation.
AY358847 mRNA Translation: AAQ89206.1
AK123443 mRNA Translation: BAG53905.1
AK125256 mRNA Translation: BAG54175.1
AL096843 Genomic DNA No translation available.
AL096853 Genomic DNA No translation available.
Z83837 Genomic DNA No translation available.
Z84468 Genomic DNA No translation available.
BC039396 mRNA Translation: AAH39396.2 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46728.1 [Q7Z5A7-1]
CCDS46729.1 [Q7Z5A7-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001076436.1, NM_001082967.2 [Q7Z5A7-1]
NP_056196.2, NM_015381.6 [Q7Z5A7-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000358295; ENSP00000351043; ENSG00000219438 [Q7Z5A7-2]
ENST00000402357; ENSP00000383933; ENSG00000219438 [Q7Z5A7-1]
ENST00000406880; ENSP00000385603; ENSG00000219438 [Q7Z5A7-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
25817

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:25817

UCSC genome browser

More...
UCSCi
uc003bim.6 human [Q7Z5A7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY325118 mRNA Translation: AAP92410.1
AF131851 mRNA Translation: AAD20061.1 Different initiation.
AY358847 mRNA Translation: AAQ89206.1
AK123443 mRNA Translation: BAG53905.1
AK125256 mRNA Translation: BAG54175.1
AL096843 Genomic DNA No translation available.
AL096853 Genomic DNA No translation available.
Z83837 Genomic DNA No translation available.
Z84468 Genomic DNA No translation available.
BC039396 mRNA Translation: AAH39396.2 Different initiation.
CCDSiCCDS46728.1 [Q7Z5A7-1]
CCDS46729.1 [Q7Z5A7-2]
RefSeqiNP_001076436.1, NM_001082967.2 [Q7Z5A7-1]
NP_056196.2, NM_015381.6 [Q7Z5A7-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi117345, 18 interactors
IntActiQ7Z5A7, 1 interactor
MINTiQ7Z5A7
STRINGi9606.ENSP00000383933

PTM databases

iPTMnetiQ7Z5A7
PhosphoSitePlusiQ7Z5A7

Polymorphism and mutation databases

BioMutaiFAM19A5
DMDMi205371754

Proteomic databases

MassIVEiQ7Z5A7
PaxDbiQ7Z5A7
PeptideAtlasiQ7Z5A7
PRIDEiQ7Z5A7
ProteomicsDBi69275 [Q7Z5A7-1]
69276 [Q7Z5A7-2]
69277 [Q7Z5A7-3]

Genome annotation databases

EnsembliENST00000358295; ENSP00000351043; ENSG00000219438 [Q7Z5A7-2]
ENST00000402357; ENSP00000383933; ENSG00000219438 [Q7Z5A7-1]
ENST00000406880; ENSP00000385603; ENSG00000219438 [Q7Z5A7-3]
GeneIDi25817
KEGGihsa:25817
UCSCiuc003bim.6 human [Q7Z5A7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
25817
DisGeNETi25817

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TAFA5
HGNCiHGNC:21592 TAFA5
HPAiCAB025629
MIMi617499 gene
neXtProtiNX_Q7Z5A7
OpenTargetsiENSG00000219438
PharmGKBiPA134887312

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IZKE Eukaryota
ENOG410YTJG LUCA
GeneTreeiENSGT00940000160682
InParanoidiQ7Z5A7
OMAiPRMSSTF
OrthoDBi1417753at2759
PhylomeDBiQ7Z5A7
TreeFamiTF331749

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FAM19A5 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
FAM19A5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
25817
PharosiQ7Z5A7

Protein Ontology

More...
PROi
PR:Q7Z5A7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000219438 Expressed in 151 organ(s), highest expression level in tibial nerve
ExpressionAtlasiQ7Z5A7 baseline and differential
GenevisibleiQ7Z5A7 HS

Family and domain databases

InterProiView protein in InterPro
IPR020350 Chemokine-like_TAFA
IPR040329 TAFA-5
PANTHERiPTHR31878 PTHR31878, 1 hit
PfamiView protein in Pfam
PF12020 TAFA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTAFA5_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7Z5A7
Secondary accession number(s): A6NII9
, B0QZ13, B0QZ14, B0QZ15, O95902, Q5H9C4, Q6UWC9, Q8IXR8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: September 2, 2008
Last modified: October 16, 2019
This is version 112 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again