Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Spermatogenesis-associated protein 21

Gene

SPATA21

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Involved in the differentiation of haploid spermatids.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi268 – 279PROSITE-ProRule annotationAdd BLAST12

GO - Molecular functioni

Keywordsi

LigandCalcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Spermatogenesis-associated protein 21
Gene namesi
Name:SPATA21
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000187144.11
HGNCiHGNC:28026 SPATA21
neXtProtiNX_Q7Z572

Pathology & Biotechi

Organism-specific databases

DisGeNETi374955
OpenTargetsiENSG00000187144
PharmGKBiPA142670886

Polymorphism and mutation databases

BioMutaiSPATA21
DMDMi215274212

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003306861 – 469Spermatogenesis-associated protein 21Add BLAST469

Proteomic databases

EPDiQ7Z572
PaxDbiQ7Z572
PeptideAtlasiQ7Z572
PRIDEiQ7Z572
ProteomicsDBi69262

PTM databases

iPTMnetiQ7Z572
PhosphoSitePlusiQ7Z572

Expressioni

Gene expression databases

BgeeiENSG00000187144 Expressed in 152 organ(s), highest expression level in buccal mucosa cell
CleanExiHS_SPATA21
ExpressionAtlasiQ7Z572 baseline and differential
GenevisibleiQ7Z572 HS

Organism-specific databases

HPAiHPA032080

Interactioni

Protein-protein interaction databases

BioGridi131941, 2 interactors
STRINGi9606.ENSP00000335612

Structurei

3D structure databases

ProteinModelPortaliQ7Z572
SMRiQ7Z572
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini255 – 290EF-handPROSITE-ProRule annotationAdd BLAST36

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili198 – 225Sequence analysisAdd BLAST28

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi114 – 170Pro-richAdd BLAST57

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0027 Eukaryota
COG5126 LUCA
GeneTreeiENSGT00530000063748
HOGENOMiHOG000154401
HOVERGENiHBG107135
InParanoidiQ7Z572
OMAiTCKAQEM
OrthoDBiEOG091G08U6
PhylomeDBiQ7Z572
TreeFamiTF328393

Family and domain databases

CDDicd00051 EFh, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
SMARTiView protein in SMART
SM00054 EFh, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q7Z572-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDNRNTQMYT EEEKTVNPFL PSTPGPKKAK GGGEAVETHP APGPLPPPEV
60 70 80 90 100
RDIGERREPD RAQQQPQKPA VAAGTQSLGN FRQGFMKCLL EVEKMEASHR
110 120 130 140 150
RASKARSQTA QKSPRTLTPV PTSAPSLPQT PASVPASGPS WARLPAPGPE
160 170 180 190 200
PAPMGAPVPT SMPCPVLLGP ALDLGWRRME LLHQSSERTL SYAKARQEPE
210 220 230 240 250
EQSLQKLYQN REKSEEQLTL KQEEAFRSYF EIFNGPGEVD AQSLKNILLL
260 270 280 290 300
MGFSVTLAQV EDALMSADVN GDGRVDFKDF LAVMTDTRRF FCSVEQNALS
310 320 330 340 350
DMAPHNPHTL LFEILSLLVE MLALPEAVLE EITNYYQKKL KEGTCKAQEM
360 370 380 390 400
EAAVGRLRLQ KLPYNPQQEE SSEVPERKVL SILSRLKQQN YAPNLQSPYA
410 420 430 440 450
QVPCILLCPQ LDKKMVRRQP SNHYALDQCT PPGLDPDIRS PFFQSGSQGN
460
REHNSDSRKW LSSVPARTH
Length:469
Mass (Da):52,207
Last modified:November 25, 2008 - v3
Checksum:i9F34A50331774C5D
GO
Isoform 2 (identifier: Q7Z572-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MDNRNTQMYTEEEKTVNPFLPSTPGPKKAKGGGEAVETHPAPGPLPPP → MAQPGAVEHACHPSTLGGQGGGSLE

Note: No experimental confirmation available.
Show »
Length:446
Mass (Da):49,484
Checksum:i583162496EB1BC90
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5VXG6Q5VXG6_HUMAN
SPATA21 protein
SPATA21
200Annotation score:
H7C5T0H7C5T0_HUMAN
Spermatogenesis-associated protein ...
SPATA21
160Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti417R → C in AAI50599 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04271124P → S in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_04271253I → L. Corresponds to variant dbSNP:rs12087671Ensembl.1
Natural variantiVAR_042713184Q → R. Corresponds to variant dbSNP:rs4661746Ensembl.1
Natural variantiVAR_042714255V → L1 PublicationCorresponds to variant dbSNP:rs525409Ensembl.1
Natural variantiVAR_042715390N → K. Corresponds to variant dbSNP:rs12133574Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0538651 – 48MDNRN…PLPPP → MAQPGAVEHACHPSTLGGQG GGSLE in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY327405 mRNA Translation: AAP92797.1
AL358794 Genomic DNA No translation available.
CH471167 Genomic DNA Translation: EAW51779.1
BC150598 mRNA Translation: AAI50599.1
CCDSiCCDS172.1 [Q7Z572-1]
CCDS85935.1 [Q7Z572-2]
RefSeqiNP_940948.1, NM_198546.1 [Q7Z572-1]
XP_016856713.1, XM_017001224.1 [Q7Z572-2]
UniGeneiHs.705501

Genome annotation databases

EnsembliENST00000335496; ENSP00000335612; ENSG00000187144 [Q7Z572-1]
ENST00000540400; ENSP00000440046; ENSG00000187144 [Q7Z572-2]
GeneIDi374955
KEGGihsa:374955
UCSCiuc001ayn.3 human [Q7Z572-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSPT21_HUMAN
AccessioniPrimary (citable) accession number: Q7Z572
Secondary accession number(s): B9EK40, F5GXP5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: November 25, 2008
Last modified: September 12, 2018
This is version 126 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again