Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lysozyme-like protein 2

Gene

LYZL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. EC:3.2.1.17

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei54PROSITE-ProRule annotation1
Active sitei71PROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGlycosidase, Hydrolase

Protein family/group databases

Carbohydrate-Active enZymes

More...
CAZyi
GH22 Glycoside Hydrolase Family 22

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lysozyme-like protein 2 (EC:3.2.1.17)
Short name:
Lysozyme-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LYZL2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000151033.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29613 LYZL2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612748 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7Z4W2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
119180

Open Targets

More...
OpenTargetsi
ENSG00000151033

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134920379

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LYZL2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
109892575

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Sequence analysisAdd BLAST19
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000024063720 – 148Lysozyme-like protein 2Add BLAST129

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi25 ↔ 145PROSITE-ProRule annotation
Disulfide bondi49 ↔ 133PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi58N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi83 ↔ 98PROSITE-ProRule annotation
Disulfide bondi94 ↔ 112PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7Z4W2

PeptideAtlas

More...
PeptideAtlasi
Q7Z4W2

PRoteomics IDEntifications database

More...
PRIDEi
Q7Z4W2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
69251
69252 [Q7Z4W2-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7Z4W2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7Z4W2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in testis, epididymis and placenta.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000151033 Expressed in 18 organ(s), highest expression level in right testis

CleanEx database of gene expression profiles

More...
CleanExi
HS_LYZL2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7Z4W2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7Z4W2 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.Curated

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125634, 60 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000364467

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q7Z4W2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7Z4W2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the glycosyl hydrolase 22 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IVGA Eukaryota
ENOG410ZG9G LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159227

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000037357

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052297

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7Z4W2

KEGG Orthology (KO)

More...
KOi
K01185

Identification of Orthologs from Complete Genome Data

More...
OMAi
WKKDCEV

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0R9V

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7Z4W2

TreeFam database of animal gene trees

More...
TreeFami
TF324882

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00119 LYZ1, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001916 Glyco_hydro_22
IPR019799 Glyco_hydro_22_CS
IPR000974 Glyco_hydro_22_lys
IPR023346 Lysozyme-like_dom_sf
IPR030057 LYZL1/LYZL2

The PANTHER Classification System

More...
PANTHERi
PTHR11407:SF26 PTHR11407:SF26, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00062 Lys, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00137 LYSOZYME
PR00135 LYZLACT

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00263 LYZ1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53955 SSF53955, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00128 LACTALBUMIN_LYSOZYME_1, 1 hit
PS51348 LACTALBUMIN_LYSOZYME_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q7Z4W2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKAAGILTLI GCLVTGAESK IYTRCKLAKI FSRAGLDNYW GFSLGNWICM
60 70 80 90 100
AYYESGYNTT AQTVLDDGSI DYGIFQINSF AWCRRGKLKE NNHCHVACSA
110 120 130 140
LVTDDLTDAI ICAKKIVKET QGMNYWQGWK KHCEGRDLSD WKKDCEVS
Length:148
Mass (Da):16,656
Last modified:June 27, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4674158A2A5912F2
GO
Isoform 2 (identifier: Q7Z4W2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRM

Show »
Length:194
Mass (Da):21,584
Checksum:i81A2CCB4C2DD597E
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_026818144D → G1 PublicationCorresponds to variant dbSNP:rs1054570Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0197171M → MQDAPLSCLSPTKWSSVSSA DSTEKSASAAGTRNLPFQFC LRQALRM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF139543 mRNA Translation: AAP97272.1
AL451107 Genomic DNA No translation available.
BC066294 mRNA Translation: AAH66294.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7167.2 [Q7Z4W2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_898881.2, NM_183058.2 [Q7Z4W2-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.522610

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000375318; ENSP00000364467; ENSG00000151033 [Q7Z4W2-2]
ENST00000647634; ENSP00000497408; ENSG00000151033 [Q7Z4W2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
119180

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:119180

UCSC genome browser

More...
UCSCi
uc001ivk.4 human [Q7Z4W2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF139543 mRNA Translation: AAP97272.1
AL451107 Genomic DNA No translation available.
BC066294 mRNA Translation: AAH66294.1
CCDSiCCDS7167.2 [Q7Z4W2-1]
RefSeqiNP_898881.2, NM_183058.2 [Q7Z4W2-1]
UniGeneiHs.522610

3D structure databases

ProteinModelPortaliQ7Z4W2
SMRiQ7Z4W2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125634, 60 interactors
STRINGi9606.ENSP00000364467

Protein family/group databases

CAZyiGH22 Glycoside Hydrolase Family 22

PTM databases

iPTMnetiQ7Z4W2
PhosphoSitePlusiQ7Z4W2

Polymorphism and mutation databases

BioMutaiLYZL2
DMDMi109892575

Proteomic databases

PaxDbiQ7Z4W2
PeptideAtlasiQ7Z4W2
PRIDEiQ7Z4W2
ProteomicsDBi69251
69252 [Q7Z4W2-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
119180
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375318; ENSP00000364467; ENSG00000151033 [Q7Z4W2-2]
ENST00000647634; ENSP00000497408; ENSG00000151033 [Q7Z4W2-1]
GeneIDi119180
KEGGihsa:119180
UCSCiuc001ivk.4 human [Q7Z4W2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
119180
DisGeNETi119180
EuPathDBiHostDB:ENSG00000151033.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LYZL2
HGNCiHGNC:29613 LYZL2
MIMi612748 gene
neXtProtiNX_Q7Z4W2
OpenTargetsiENSG00000151033
PharmGKBiPA134920379

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IVGA Eukaryota
ENOG410ZG9G LUCA
GeneTreeiENSGT00940000159227
HOGENOMiHOG000037357
HOVERGENiHBG052297
InParanoidiQ7Z4W2
KOiK01185
OMAiWKKDCEV
OrthoDBiEOG091G0R9V
PhylomeDBiQ7Z4W2
TreeFamiTF324882

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
119180

Protein Ontology

More...
PROi
PR:Q7Z4W2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000151033 Expressed in 18 organ(s), highest expression level in right testis
CleanExiHS_LYZL2
ExpressionAtlasiQ7Z4W2 baseline and differential
GenevisibleiQ7Z4W2 HS

Family and domain databases

CDDicd00119 LYZ1, 1 hit
InterProiView protein in InterPro
IPR001916 Glyco_hydro_22
IPR019799 Glyco_hydro_22_CS
IPR000974 Glyco_hydro_22_lys
IPR023346 Lysozyme-like_dom_sf
IPR030057 LYZL1/LYZL2
PANTHERiPTHR11407:SF26 PTHR11407:SF26, 1 hit
PfamiView protein in Pfam
PF00062 Lys, 1 hit
PRINTSiPR00137 LYSOZYME
PR00135 LYZLACT
SMARTiView protein in SMART
SM00263 LYZ1, 1 hit
SUPFAMiSSF53955 SSF53955, 1 hit
PROSITEiView protein in PROSITE
PS00128 LACTALBUMIN_LYSOZYME_1, 1 hit
PS51348 LACTALBUMIN_LYSOZYME_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLYZL2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7Z4W2
Secondary accession number(s): Q6NZ69
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: December 5, 2018
This is version 119 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again