Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 162 (13 Feb 2019)
Sequence version 2 (19 Jul 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Kinesin-like protein KIF21A

Gene

KIF21A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Microtubule-binding motor protein probably involved in neuronal axonal transport. In vitro, has a plus-end directed motor activity (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi88 – 95ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189 Kinesins

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q7Z4S6

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinesin-like protein KIF21A
Alternative name(s):
Kinesin-like protein KIF2
Renal carcinoma antigen NY-REN-62
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KIF21A
Synonyms:KIAA1708, KIF2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000139116.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19349 KIF21A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608283 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7Z4S6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Fibrosis of extraocular muscles, congenital, 1 (CFEOM1)4 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA congenital ocular motility disorder marked by restrictive ophthalmoplegia affecting extraocular muscles innervated by the oculomotor and/or trochlear nerves. It is clinically characterized by anchoring of the eyes in downward gaze, ptosis, and backward tilt of the head. Patients affected by congenital fibrosis of extraocular muscles type 1 show an absence of the superior division of the oculomotor nerve (cranial nerve III) and corresponding oculomotor subnuclei.
See also OMIM:135700
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_074031352D → E in CFEOM1; de novo mutation. 1 Publication1
Natural variantiVAR_019399356M → T in CFEOM1. 2 PublicationsCorresponds to variant dbSNP:rs121912588EnsemblClinVar.1
Natural variantiVAR_074032944E → Q in CFEOM1. 1 Publication1
Natural variantiVAR_019400947M → R in CFEOM1. 1 PublicationCorresponds to variant dbSNP:rs121912590EnsemblClinVar.1
Natural variantiVAR_027021947M → T in CFEOM1. 1 Publication1
Natural variantiVAR_019401947M → V in CFEOM1. 1 PublicationCorresponds to variant dbSNP:rs121912589EnsemblClinVar.1
Natural variantiVAR_074033954R → L in CFEOM1. 1 Publication1
Natural variantiVAR_019402954R → Q in CFEOM1. 2 PublicationsCorresponds to variant dbSNP:rs121912586EnsemblClinVar.1
Natural variantiVAR_019403954R → W in CFEOM1. 2 PublicationsCorresponds to variant dbSNP:rs121912585EnsemblClinVar.1
Natural variantiVAR_0740341008A → P in CFEOM1. 1 Publication1
Natural variantiVAR_0194041010I → T in CFEOM1. 1 PublicationCorresponds to variant dbSNP:rs121912587EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
55605

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
KIF21A

MalaCards human disease database

More...
MalaCardsi
KIF21A
MIMi135700 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000139116

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
45358 Congenital fibrosis of extraocular muscles

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134882934

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KIF21A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
50400977

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001254621 – 1674Kinesin-like protein KIF21AAdd BLAST1674

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei524PhosphoserineCombined sources1
Modified residuei1212PhosphoserineCombined sources1
Modified residuei1225PhosphoserineCombined sources1
Modified residuei1229PhosphoserineCombined sources1
Modified residuei1239PhosphoserineCombined sources1
Modified residuei1662PhosphoserineCombined sources1
Modified residuei1664PhosphothreonineCombined sources1
Modified residuei1673PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7Z4S6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q7Z4S6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q7Z4S6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7Z4S6

PeptideAtlas

More...
PeptideAtlasi
Q7Z4S6

PRoteomics IDEntifications database

More...
PRIDEi
Q7Z4S6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
69226
69227 [Q7Z4S6-2]
69228 [Q7Z4S6-3]
69229 [Q7Z4S6-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7Z4S6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7Z4S6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000139116 Expressed in 205 organ(s), highest expression level in dorsal root ganglion

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7Z4S6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7Z4S6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB022079
HPA058432

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120746, 54 interactors

Database of interacting proteins

More...
DIPi
DIP-56253N

Protein interaction database and analysis system

More...
IntActi
Q7Z4S6, 46 interactors

Molecular INTeraction database

More...
MINTi
Q7Z4S6

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000354878

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11674
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5D3AX-ray2.50A/B938-1017[»]
5NFDX-ray2.18A/B938-1017[»]
5YBUX-ray1.89B1146-1167[»]
5YBVX-ray2.12C/D1146-1167[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q7Z4S6

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7Z4S6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini9 – 371Kinesin motorPROSITE-ProRule annotationAdd BLAST363
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1345 – 1382WD 1Add BLAST38
Repeati1385 – 1423WD 2Add BLAST39
Repeati1449 – 1487WD 3Add BLAST39
Repeati1490 – 1532WD 4Add BLAST43
Repeati1541 – 1578WD 5Add BLAST38
Repeati1582 – 1621WD 6Add BLAST40
Repeati1624 – 1661WD 7Add BLAST38

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili365 – 575Sequence analysisAdd BLAST211
Coiled coili931 – 1019Sequence analysisAdd BLAST89
Coiled coili1053 – 1083Sequence analysisAdd BLAST31

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0244 Eukaryota
COG5059 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155323

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000280728

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052247

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7Z4S6

KEGG Orthology (KO)

More...
KOi
K10395

Identification of Orthologs from Complete Genome Data

More...
OMAi
AGAQQKM

Database of Orthologous Groups

More...
OrthoDBi
390391at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7Z4S6

TreeFam database of animal gene trees

More...
TreeFami
TF105224

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 3 hits
3.40.850.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR24115 PTHR24115, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00225 Kinesin, 1 hit
PF00400 WD40, 4 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00380 KINESINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00129 KISc, 1 hit
SM00320 WD40, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978 SSF50978, 1 hit
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 4 hits
PS50294 WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z4S6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLGAPDESSV RVAVRIRPQL AKEKIEGCHI CTSVTPGEPQ VFLGKDKAFT
60 70 80 90 100
FDYVFDIDSQ QEQIYIQCIE KLIEGCFEGY NATVFAYGQT GAGKTYTMGT
110 120 130 140 150
GFDVNIVEEE LGIISRAVKH LFKSIEEKKH IAIKNGLPAP DFKVNAQFLE
160 170 180 190 200
LYNEEVLDLF DTTRDIDAKS KKSNIRIHED STGGIYTVGV TTRTVNTESE
210 220 230 240 250
MMQCLKLGAL SRTTASTQMN VQSSRSHAIF TIHVCQTRVC PQIDADNATD
260 270 280 290 300
NKIISESAQM NEFETLTAKF HFVDLAGSER LKRTGATGER AKEGISINCG
310 320 330 340 350
LLALGNVISA LGDKSKRATH VPYRDSKLTR LLQDSLGGNS QTIMIACVSP
360 370 380 390 400
SDRDFMETLN TLKYANRARN IKNKVMVNQD RASQQINALR SEITRLQMEL
410 420 430 440 450
MEYKTGKRII DEEGVESIND MFHENAMLQT ENNNLRVRIK AMQETVDALR
460 470 480 490 500
SRITQLVSDQ ANHVLARAGE GNEEISNMIH SYIKEIEDLR AKLLESEAVN
510 520 530 540 550
ENLRKNLTRA TARAPYFSGS STFSPTILSS DKETIEIIDL AKKDLEKLKR
560 570 580 590 600
KEKRKKKRLQ KLEESNREER SVAGKEDNTD TDQEKKEEKG VSERENNELE
610 620 630 640 650
VEESQEVSDH EDEEEEEEEE EDDIDGGESS DESDSESDEK ANYQADLANI
660 670 680 690 700
TCEIAIKQKL IDELENSQKR LQTLKKQYEE KLMMLQHKIR DTQLERDQVL
710 720 730 740 750
QNLGSVESYS EEKAKKVRSE YEKKLQAMNK ELQRLQAAQK EHARLLKNQS
760 770 780 790 800
QYEKQLKKLQ QDVMEMKKTK VRLMKQMKEE QEKARLTESR RNREIAQLKK
810 820 830 840 850
DQRKRDHQLR LLEAQKRNQE VVLRRKTEEV TALRRQVRPM SDKVAGKVTR
860 870 880 890 900
KLSSSDAPAQ DTGSSAAAVE TDASRTGAQQ KMRIPVARVQ ALPTPATNGN
910 920 930 940 950
RKKYQRKGLT GRVFISKTAR MKWQLLERRV TDIIMQKMTI SNMEADMNRL
960 970 980 990 1000
LKQREELTKR REKLSKRREK IVKENGEGDK NVANINEEME SLTANIDYIN
1010 1020 1030 1040 1050
DSISDCQANI MQMEEAKEEG ETLDVTAVIN ACTLTEARYL LDHFLSMGIN
1060 1070 1080 1090 1100
KGLQAAQKEA QIKVLEGRLK QTEITSATQN QLLFHMLKEK AELNPELDAL
1110 1120 1130 1140 1150
LGHALQDLDS VPLENVEDST DEDAPLNSPG SEGSTLSSDL MKLCGEVKPK
1160 1170 1180 1190 1200
NKARRRTTTQ MELLYADSSE LASDTSTGDA SLPGPLTPVA EGQEIGMNTE
1210 1220 1230 1240 1250
TSGTSAREKE LSPPPGLPSK IGSISRQSSL SEKKIPEPSP VTRRKAYEKA
1260 1270 1280 1290 1300
EKSKAKEQKH SDSGTSEASL SPPSSPPSRP RNELNVFNRL TVSQGNTSVQ
1310 1320 1330 1340 1350
QDKSDESDSS LSEVHRSSRR GIINPFPASK GIRAFPLQCI HIAEGHTKAV
1360 1370 1380 1390 1400
LCVDSTDDLL FTGSKDRTCK VWNLVTGQEI MSLGGHPNNV VSVKYCNYTS
1410 1420 1430 1440 1450
LVFTVSTSYI KVWDIRDSAK CIRTLTSSGQ VTLGDACSAS TSRTVAIPSG
1460 1470 1480 1490 1500
ENQINQIALN PTGTFLYAAS GNAVRMWDLK RFQSTGKLTG HLGPVMCLTV
1510 1520 1530 1540 1550
DQISSGQDLI ITGSKDHYIK MFDVTEGALG TVSPTHNFEP PHYDGIEALT
1560 1570 1580 1590 1600
IQGDNLFSGS RDNGIKKWDL TQKDLLQQVP NAHKDWVCAL GVVPDHPVLL
1610 1620 1630 1640 1650
SGCRGGILKV WNMDTFMPVG EMKGHDSPIN AICVNSTHIF TAADDRTVRI
1660 1670
WKARNLQDGQ ISDTGDLGED IASN
Length:1,674
Mass (Da):187,179
Last modified:July 19, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i292AFA5F2C0C6F9A
GO
Isoform 2 (identifier: Q7Z4S6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.

Show »
Length:1,661
Mass (Da):185,510
Checksum:i62AAF4804167A918
GO
Isoform 3 (identifier: Q7Z4S6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1260-1319: HSDSGTSEASLSPPSSPPSRPRNELNVFNRLTVSQGNTSVQQDKSDESDSSLSEVHRSSR → QSDESDSSLSEVH

Note: No experimental confirmation available.
Show »
Length:1,627
Mass (Da):182,129
Checksum:iB4B2415E2E95010F
GO
Isoform 4 (identifier: Q7Z4S6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1315-1315: H → HS

Note: No experimental confirmation available.
Show »
Length:1,675
Mass (Da):187,266
Checksum:iDA1BD09FE7D3C1AF
GO
Isoform 5 (identifier: Q7Z4S6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1107-1113: Missing.
     1304-1320: Missing.

Show »
Length:1,637
Mass (Da):182,854
Checksum:iC65E7231C1EEA1B1
GO
Isoform 6 (identifier: Q7Z4S6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     807-829: Missing.
     1304-1320: Missing.

Show »
Length:1,621
Mass (Da):180,738
Checksum:iC58AFA881A960A85
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1B0GV47A0A1B0GV47_HUMAN
Kinesin-like protein KIF21A
KIF21A
1,653Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YIM7H0YIM7_HUMAN
Kinesin-like protein
KIF21A
290Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YI78H0YI78_HUMAN
Kinesin-like protein KIF21A
KIF21A
655Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHT2H0YHT2_HUMAN
Kinesin-like protein KIF21A
KIF21A
975Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YIM6H0YIM6_HUMAN
Kinesin-like protein KIF21A
KIF21A
475Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHG9H0YHG9_HUMAN
Kinesin-like protein KIF21A
KIF21A
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD42883 differs from that shown. Reason: Frameshift at positions 185, 191, 380 and 405.Curated
The sequence AAH41430 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAP97680 differs from that shown. Reason: Frameshift at positions 185 and 191.Curated
The sequence BAA90916 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti172K → R in CAJ45483 (Ref. 2) Curated1
Sequence conflicti176R → G in CAJ45483 (Ref. 2) Curated1
Sequence conflicti215A → G in CAJ45483 (Ref. 2) Curated1
Sequence conflicti315S → C in CAJ45483 (Ref. 2) Curated1
Sequence conflicti596 – 597NN → TQ in AAP97680 (Ref. 3) Curated2
Sequence conflicti596 – 597NN → TQ in AAD42883 (PubMed:10508479).Curated2
Sequence conflicti653E → D in AAP97680 (Ref. 3) Curated1
Sequence conflicti801 – 802DQ → AP in AAP97680 (Ref. 3) Curated2
Sequence conflicti801D → G in CAJ45483 (Ref. 2) Curated1
Sequence conflicti813E → G in AAP97680 (Ref. 3) Curated1
Sequence conflicti826K → Q in AAP97680 (Ref. 3) Curated1
Sequence conflicti875R → G in CAJ45483 (Ref. 2) Curated1
Sequence conflicti892L → S in CAJ45483 (Ref. 2) Curated1
Sequence conflicti1071Q → R in CAJ45483 (Ref. 2) Curated1
Sequence conflicti1167D → G in CAJ45483 (Ref. 2) Curated1
Sequence conflicti1237E → D in AAI36415 (PubMed:15489334).Curated1
Sequence conflicti1341H → N in CAJ45483 (Ref. 2) Curated1
Sequence conflicti1378 – 1379QE → HR in CAJ45483 (Ref. 2) Curated2
Sequence conflicti1429G → A in CAJ45483 (Ref. 2) Curated1
Sequence conflicti1503I → T in CAD97863 (PubMed:17974005).Curated1
Sequence conflicti1511I → T in CAD97863 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_074031352D → E in CFEOM1; de novo mutation. 1 Publication1
Natural variantiVAR_019399356M → T in CFEOM1. 2 PublicationsCorresponds to variant dbSNP:rs121912588EnsemblClinVar.1
Natural variantiVAR_074032944E → Q in CFEOM1. 1 Publication1
Natural variantiVAR_019400947M → R in CFEOM1. 1 PublicationCorresponds to variant dbSNP:rs121912590EnsemblClinVar.1
Natural variantiVAR_027021947M → T in CFEOM1. 1 Publication1
Natural variantiVAR_019401947M → V in CFEOM1. 1 PublicationCorresponds to variant dbSNP:rs121912589EnsemblClinVar.1
Natural variantiVAR_074033954R → L in CFEOM1. 1 Publication1
Natural variantiVAR_019402954R → Q in CFEOM1. 2 PublicationsCorresponds to variant dbSNP:rs121912586EnsemblClinVar.1
Natural variantiVAR_019403954R → W in CFEOM1. 2 PublicationsCorresponds to variant dbSNP:rs121912585EnsemblClinVar.1
Natural variantiVAR_0740341008A → P in CFEOM1. 1 Publication1
Natural variantiVAR_0194041010I → T in CFEOM1. 1 PublicationCorresponds to variant dbSNP:rs121912587EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_010870558 – 570Missing in isoform 2, isoform 5 and isoform 6. 7 PublicationsAdd BLAST13
Alternative sequenceiVSP_046790807 – 829Missing in isoform 6. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_0467911107 – 1113Missing in isoform 5. 1 Publication7
Alternative sequenceiVSP_0108711260 – 1319HSDSG…HRSSR → QSDESDSSLSEVH in isoform 3. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_0467921304 – 1320Missing in isoform 5 and isoform 6. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_0108721315H → HS in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY368076 mRNA Translation: AAR04774.1
AM177179 mRNA Translation: CAJ45483.1
AF450487 mRNA Translation: AAP97680.1 Frameshift.
AB290166 mRNA Translation: BAG06720.1
AC084373 Genomic DNA No translation available.
AC090668 Genomic DNA No translation available.
AC121334 Genomic DNA No translation available.
AF155117 mRNA Translation: AAD42883.1 Sequence problems.
AK000059 mRNA Translation: BAA90916.1 Sequence problems.
CH471111 Genomic DNA Translation: EAW57803.1
BC041430 mRNA Translation: AAH41430.1 Sequence problems.
BC047572 mRNA Translation: AAH47572.1
BC136414 mRNA Translation: AAI36415.1
AB051495 mRNA Translation: BAB21799.2
BX537855 mRNA Translation: CAD97863.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31773.1 [Q7Z4S6-2]
CCDS53774.1 [Q7Z4S6-6]
CCDS53775.1 [Q7Z4S6-5]
CCDS53776.1 [Q7Z4S6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001166934.1, NM_001173463.1 [Q7Z4S6-5]
NP_001166935.1, NM_001173464.1 [Q7Z4S6-1]
NP_001166936.1, NM_001173465.1 [Q7Z4S6-6]
NP_060111.2, NM_017641.3 [Q7Z4S6-2]
XP_005269064.1, XM_005269007.2 [Q7Z4S6-4]
XP_005269070.1, XM_005269013.2 [Q7Z4S6-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.374201

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000361418; ENSP00000354878; ENSG00000139116 [Q7Z4S6-1]
ENST00000361961; ENSP00000354851; ENSG00000139116 [Q7Z4S6-2]
ENST00000541463; ENSP00000438075; ENSG00000139116 [Q7Z4S6-6]
ENST00000544797; ENSP00000445606; ENSG00000139116 [Q7Z4S6-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55605

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55605

UCSC genome browser

More...
UCSCi
uc001rlx.4 human [Q7Z4S6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY368076 mRNA Translation: AAR04774.1
AM177179 mRNA Translation: CAJ45483.1
AF450487 mRNA Translation: AAP97680.1 Frameshift.
AB290166 mRNA Translation: BAG06720.1
AC084373 Genomic DNA No translation available.
AC090668 Genomic DNA No translation available.
AC121334 Genomic DNA No translation available.
AF155117 mRNA Translation: AAD42883.1 Sequence problems.
AK000059 mRNA Translation: BAA90916.1 Sequence problems.
CH471111 Genomic DNA Translation: EAW57803.1
BC041430 mRNA Translation: AAH41430.1 Sequence problems.
BC047572 mRNA Translation: AAH47572.1
BC136414 mRNA Translation: AAI36415.1
AB051495 mRNA Translation: BAB21799.2
BX537855 mRNA Translation: CAD97863.1
CCDSiCCDS31773.1 [Q7Z4S6-2]
CCDS53774.1 [Q7Z4S6-6]
CCDS53775.1 [Q7Z4S6-5]
CCDS53776.1 [Q7Z4S6-1]
RefSeqiNP_001166934.1, NM_001173463.1 [Q7Z4S6-5]
NP_001166935.1, NM_001173464.1 [Q7Z4S6-1]
NP_001166936.1, NM_001173465.1 [Q7Z4S6-6]
NP_060111.2, NM_017641.3 [Q7Z4S6-2]
XP_005269064.1, XM_005269007.2 [Q7Z4S6-4]
XP_005269070.1, XM_005269013.2 [Q7Z4S6-3]
UniGeneiHs.374201

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5D3AX-ray2.50A/B938-1017[»]
5NFDX-ray2.18A/B938-1017[»]
5YBUX-ray1.89B1146-1167[»]
5YBVX-ray2.12C/D1146-1167[»]
ProteinModelPortaliQ7Z4S6
SMRiQ7Z4S6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120746, 54 interactors
DIPiDIP-56253N
IntActiQ7Z4S6, 46 interactors
MINTiQ7Z4S6
STRINGi9606.ENSP00000354878

PTM databases

iPTMnetiQ7Z4S6
PhosphoSitePlusiQ7Z4S6

Polymorphism and mutation databases

BioMutaiKIF21A
DMDMi50400977

Proteomic databases

EPDiQ7Z4S6
jPOSTiQ7Z4S6
MaxQBiQ7Z4S6
PaxDbiQ7Z4S6
PeptideAtlasiQ7Z4S6
PRIDEiQ7Z4S6
ProteomicsDBi69226
69227 [Q7Z4S6-2]
69228 [Q7Z4S6-3]
69229 [Q7Z4S6-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361418; ENSP00000354878; ENSG00000139116 [Q7Z4S6-1]
ENST00000361961; ENSP00000354851; ENSG00000139116 [Q7Z4S6-2]
ENST00000541463; ENSP00000438075; ENSG00000139116 [Q7Z4S6-6]
ENST00000544797; ENSP00000445606; ENSG00000139116 [Q7Z4S6-5]
GeneIDi55605
KEGGihsa:55605
UCSCiuc001rlx.4 human [Q7Z4S6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55605
DisGeNETi55605
EuPathDBiHostDB:ENSG00000139116.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KIF21A
GeneReviewsiKIF21A
HGNCiHGNC:19349 KIF21A
HPAiCAB022079
HPA058432
MalaCardsiKIF21A
MIMi135700 phenotype
608283 gene
neXtProtiNX_Q7Z4S6
OpenTargetsiENSG00000139116
Orphaneti45358 Congenital fibrosis of extraocular muscles
PharmGKBiPA134882934

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0244 Eukaryota
COG5059 LUCA
GeneTreeiENSGT00940000155323
HOGENOMiHOG000280728
HOVERGENiHBG052247
InParanoidiQ7Z4S6
KOiK10395
OMAiAGAQQKM
OrthoDBi390391at2759
PhylomeDBiQ7Z4S6
TreeFamiTF105224

Enzyme and pathway databases

ReactomeiR-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189 Kinesins
SignaLinkiQ7Z4S6

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KIF21A human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
KIF21A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55605

Protein Ontology

More...
PROi
PR:Q7Z4S6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000139116 Expressed in 205 organ(s), highest expression level in dorsal root ganglion
ExpressionAtlasiQ7Z4S6 baseline and differential
GenevisibleiQ7Z4S6 HS

Family and domain databases

Gene3Di2.130.10.10, 3 hits
3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PF00400 WD40, 4 hits
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 4 hits
PS50294 WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKI21A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7Z4S6
Secondary accession number(s): A8MX28
, B0I1R9, B9EGE4, F5H0C3, F5H219, Q2UVF1, Q6UKL9, Q7Z668, Q86WZ5, Q8IVZ8, Q9C0F5, Q9NXU4, Q9Y590
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: February 13, 2019
This is version 162 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again