Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF21A

Gene

KIF21A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Microtubule-binding motor protein probably involved in neuronal axonal transport. In vitro, has a plus-end directed motor activity (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi88 – 95ATPPROSITE-ProRule annotation8

GO - Molecular functioni

  • ATPase activity Source: GO_Central
  • ATP binding Source: UniProtKB-KW
  • microtubule binding Source: GO_Central
  • microtubule motor activity Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionMotor protein
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189 Kinesins
SignaLinkiQ7Z4S6

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF21A
Alternative name(s):
Kinesin-like protein KIF2
Renal carcinoma antigen NY-REN-62
Gene namesi
Name:KIF21A
Synonyms:KIAA1708, KIF2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000139116.17
HGNCiHGNC:19349 KIF21A
MIMi608283 gene
neXtProtiNX_Q7Z4S6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Involvement in diseasei

Fibrosis of extraocular muscles, congenital, 1 (CFEOM1)4 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA congenital ocular motility disorder marked by restrictive ophthalmoplegia affecting extraocular muscles innervated by the oculomotor and/or trochlear nerves. It is clinically characterized by anchoring of the eyes in downward gaze, ptosis, and backward tilt of the head. Patients affected by congenital fibrosis of extraocular muscles type 1 show an absence of the superior division of the oculomotor nerve (cranial nerve III) and corresponding oculomotor subnuclei.
See also OMIM:135700
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_074031352D → E in CFEOM1; de novo mutation. 1 Publication1
Natural variantiVAR_019399356M → T in CFEOM1. 2 PublicationsCorresponds to variant dbSNP:rs121912588EnsemblClinVar.1
Natural variantiVAR_074032944E → Q in CFEOM1. 1 Publication1
Natural variantiVAR_019400947M → R in CFEOM1. 1 PublicationCorresponds to variant dbSNP:rs121912590EnsemblClinVar.1
Natural variantiVAR_027021947M → T in CFEOM1. 1 Publication1
Natural variantiVAR_019401947M → V in CFEOM1. 1 PublicationCorresponds to variant dbSNP:rs121912589EnsemblClinVar.1
Natural variantiVAR_074033954R → L in CFEOM1. 1 Publication1
Natural variantiVAR_019402954R → Q in CFEOM1. 2 PublicationsCorresponds to variant dbSNP:rs121912586EnsemblClinVar.1
Natural variantiVAR_019403954R → W in CFEOM1. 2 PublicationsCorresponds to variant dbSNP:rs121912585EnsemblClinVar.1
Natural variantiVAR_0740341008A → P in CFEOM1. 1 Publication1
Natural variantiVAR_0194041010I → T in CFEOM1. 1 PublicationCorresponds to variant dbSNP:rs121912587EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi55605
GeneReviewsiKIF21A
MalaCardsiKIF21A
MIMi135700 phenotype
OpenTargetsiENSG00000139116
Orphaneti45358 Congenital fibrosis of extraocular muscles
PharmGKBiPA134882934

Polymorphism and mutation databases

BioMutaiKIF21A
DMDMi50400977

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001254621 – 1674Kinesin-like protein KIF21AAdd BLAST1674

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei524PhosphoserineCombined sources1
Modified residuei1212PhosphoserineCombined sources1
Modified residuei1225PhosphoserineCombined sources1
Modified residuei1229PhosphoserineCombined sources1
Modified residuei1239PhosphoserineCombined sources1
Modified residuei1662PhosphoserineCombined sources1
Modified residuei1664PhosphothreonineCombined sources1
Modified residuei1673PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ7Z4S6
MaxQBiQ7Z4S6
PaxDbiQ7Z4S6
PeptideAtlasiQ7Z4S6
PRIDEiQ7Z4S6
ProteomicsDBi69226
69227 [Q7Z4S6-2]
69228 [Q7Z4S6-3]
69229 [Q7Z4S6-4]

PTM databases

iPTMnetiQ7Z4S6
PhosphoSitePlusiQ7Z4S6

Expressioni

Gene expression databases

BgeeiENSG00000139116 Expressed in 205 organ(s), highest expression level in dorsal root ganglion
CleanExiHS_KIF21A
ExpressionAtlasiQ7Z4S6 baseline and differential
GenevisibleiQ7Z4S6 HS

Organism-specific databases

HPAiCAB022079
HPA058432

Interactioni

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi120746, 52 interactors
DIPiDIP-56253N
IntActiQ7Z4S6, 44 interactors
MINTiQ7Z4S6
STRINGi9606.ENSP00000354878

Structurei

Secondary structure

11674
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ7Z4S6
SMRiQ7Z4S6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini9 – 371Kinesin motorPROSITE-ProRule annotationAdd BLAST363
Repeati1345 – 1382WD 1Add BLAST38
Repeati1385 – 1423WD 2Add BLAST39
Repeati1449 – 1487WD 3Add BLAST39
Repeati1490 – 1532WD 4Add BLAST43
Repeati1541 – 1578WD 5Add BLAST38
Repeati1582 – 1621WD 6Add BLAST40
Repeati1624 – 1661WD 7Add BLAST38

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili365 – 575Sequence analysisAdd BLAST211
Coiled coili931 – 1019Sequence analysisAdd BLAST89
Coiled coili1053 – 1083Sequence analysisAdd BLAST31

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0244 Eukaryota
COG5059 LUCA
GeneTreeiENSGT00930000150846
HOGENOMiHOG000280728
HOVERGENiHBG052247
InParanoidiQ7Z4S6
KOiK10395
OMAiAGAQQKM
OrthoDBiEOG091G0DUL
PhylomeDBiQ7Z4S6
TreeFamiTF105224

Family and domain databases

Gene3Di2.130.10.10, 3 hits
3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PF00400 WD40, 4 hits
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 4 hits
PS50294 WD_REPEATS_REGION, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z4S6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLGAPDESSV RVAVRIRPQL AKEKIEGCHI CTSVTPGEPQ VFLGKDKAFT
60 70 80 90 100
FDYVFDIDSQ QEQIYIQCIE KLIEGCFEGY NATVFAYGQT GAGKTYTMGT
110 120 130 140 150
GFDVNIVEEE LGIISRAVKH LFKSIEEKKH IAIKNGLPAP DFKVNAQFLE
160 170 180 190 200
LYNEEVLDLF DTTRDIDAKS KKSNIRIHED STGGIYTVGV TTRTVNTESE
210 220 230 240 250
MMQCLKLGAL SRTTASTQMN VQSSRSHAIF TIHVCQTRVC PQIDADNATD
260 270 280 290 300
NKIISESAQM NEFETLTAKF HFVDLAGSER LKRTGATGER AKEGISINCG
310 320 330 340 350
LLALGNVISA LGDKSKRATH VPYRDSKLTR LLQDSLGGNS QTIMIACVSP
360 370 380 390 400
SDRDFMETLN TLKYANRARN IKNKVMVNQD RASQQINALR SEITRLQMEL
410 420 430 440 450
MEYKTGKRII DEEGVESIND MFHENAMLQT ENNNLRVRIK AMQETVDALR
460 470 480 490 500
SRITQLVSDQ ANHVLARAGE GNEEISNMIH SYIKEIEDLR AKLLESEAVN
510 520 530 540 550
ENLRKNLTRA TARAPYFSGS STFSPTILSS DKETIEIIDL AKKDLEKLKR
560 570 580 590 600
KEKRKKKRLQ KLEESNREER SVAGKEDNTD TDQEKKEEKG VSERENNELE
610 620 630 640 650
VEESQEVSDH EDEEEEEEEE EDDIDGGESS DESDSESDEK ANYQADLANI
660 670 680 690 700
TCEIAIKQKL IDELENSQKR LQTLKKQYEE KLMMLQHKIR DTQLERDQVL
710 720 730 740 750
QNLGSVESYS EEKAKKVRSE YEKKLQAMNK ELQRLQAAQK EHARLLKNQS
760 770 780 790 800
QYEKQLKKLQ QDVMEMKKTK VRLMKQMKEE QEKARLTESR RNREIAQLKK
810 820 830 840 850
DQRKRDHQLR LLEAQKRNQE VVLRRKTEEV TALRRQVRPM SDKVAGKVTR
860 870 880 890 900
KLSSSDAPAQ DTGSSAAAVE TDASRTGAQQ KMRIPVARVQ ALPTPATNGN
910 920 930 940 950
RKKYQRKGLT GRVFISKTAR MKWQLLERRV TDIIMQKMTI SNMEADMNRL
960 970 980 990 1000
LKQREELTKR REKLSKRREK IVKENGEGDK NVANINEEME SLTANIDYIN
1010 1020 1030 1040 1050
DSISDCQANI MQMEEAKEEG ETLDVTAVIN ACTLTEARYL LDHFLSMGIN
1060 1070 1080 1090 1100
KGLQAAQKEA QIKVLEGRLK QTEITSATQN QLLFHMLKEK AELNPELDAL
1110 1120 1130 1140 1150
LGHALQDLDS VPLENVEDST DEDAPLNSPG SEGSTLSSDL MKLCGEVKPK
1160 1170 1180 1190 1200
NKARRRTTTQ MELLYADSSE LASDTSTGDA SLPGPLTPVA EGQEIGMNTE
1210 1220 1230 1240 1250
TSGTSAREKE LSPPPGLPSK IGSISRQSSL SEKKIPEPSP VTRRKAYEKA
1260 1270 1280 1290 1300
EKSKAKEQKH SDSGTSEASL SPPSSPPSRP RNELNVFNRL TVSQGNTSVQ
1310 1320 1330 1340 1350
QDKSDESDSS LSEVHRSSRR GIINPFPASK GIRAFPLQCI HIAEGHTKAV
1360 1370 1380 1390 1400
LCVDSTDDLL FTGSKDRTCK VWNLVTGQEI MSLGGHPNNV VSVKYCNYTS
1410 1420 1430 1440 1450
LVFTVSTSYI KVWDIRDSAK CIRTLTSSGQ VTLGDACSAS TSRTVAIPSG
1460 1470 1480 1490 1500
ENQINQIALN PTGTFLYAAS GNAVRMWDLK RFQSTGKLTG HLGPVMCLTV
1510 1520 1530 1540 1550
DQISSGQDLI ITGSKDHYIK MFDVTEGALG TVSPTHNFEP PHYDGIEALT
1560 1570 1580 1590 1600
IQGDNLFSGS RDNGIKKWDL TQKDLLQQVP NAHKDWVCAL GVVPDHPVLL
1610 1620 1630 1640 1650
SGCRGGILKV WNMDTFMPVG EMKGHDSPIN AICVNSTHIF TAADDRTVRI
1660 1670
WKARNLQDGQ ISDTGDLGED IASN
Length:1,674
Mass (Da):187,179
Last modified:July 19, 2004 - v2
Checksum:i292AFA5F2C0C6F9A
GO
Isoform 2 (identifier: Q7Z4S6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.

Show »
Length:1,661
Mass (Da):185,510
Checksum:i62AAF4804167A918
GO
Isoform 3 (identifier: Q7Z4S6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1260-1319: HSDSGTSEASLSPPSSPPSRPRNELNVFNRLTVSQGNTSVQQDKSDESDSSLSEVHRSSR → QSDESDSSLSEVH

Note: No experimental confirmation available.
Show »
Length:1,627
Mass (Da):182,129
Checksum:iB4B2415E2E95010F
GO
Isoform 4 (identifier: Q7Z4S6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1315-1315: H → HS

Note: No experimental confirmation available.
Show »
Length:1,675
Mass (Da):187,266
Checksum:iDA1BD09FE7D3C1AF
GO
Isoform 5 (identifier: Q7Z4S6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1107-1113: Missing.
     1304-1320: Missing.

Show »
Length:1,637
Mass (Da):182,854
Checksum:iC65E7231C1EEA1B1
GO
Isoform 6 (identifier: Q7Z4S6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     807-829: Missing.
     1304-1320: Missing.

Show »
Length:1,621
Mass (Da):180,738
Checksum:iC58AFA881A960A85
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1B0GV47A0A1B0GV47_HUMAN
Kinesin-like protein KIF21A
KIF21A
1,653Annotation score:
H0YIM7H0YIM7_HUMAN
Kinesin-like protein
KIF21A
290Annotation score:
H0YHT2H0YHT2_HUMAN
Kinesin-like protein KIF21A
KIF21A
975Annotation score:
H0YI78H0YI78_HUMAN
Kinesin-like protein KIF21A
KIF21A
655Annotation score:
H0YIM6H0YIM6_HUMAN
Kinesin-like protein KIF21A
KIF21A
475Annotation score:
H0YHG9H0YHG9_HUMAN
Kinesin-like protein KIF21A
KIF21A
138Annotation score:

Sequence cautioni

The sequence AAD42883 differs from that shown. Reason: Frameshift at positions 185, 191, 380 and 405.Curated
The sequence AAH41430 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAP97680 differs from that shown. Reason: Frameshift at positions 185 and 191.Curated
The sequence BAA90916 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti172K → R in CAJ45483 (Ref. 2) Curated1
Sequence conflicti176R → G in CAJ45483 (Ref. 2) Curated1
Sequence conflicti215A → G in CAJ45483 (Ref. 2) Curated1
Sequence conflicti315S → C in CAJ45483 (Ref. 2) Curated1
Sequence conflicti596 – 597NN → TQ in AAP97680 (Ref. 3) Curated2
Sequence conflicti596 – 597NN → TQ in AAD42883 (PubMed:10508479).Curated2
Sequence conflicti653E → D in AAP97680 (Ref. 3) Curated1
Sequence conflicti801 – 802DQ → AP in AAP97680 (Ref. 3) Curated2
Sequence conflicti801D → G in CAJ45483 (Ref. 2) Curated1
Sequence conflicti813E → G in AAP97680 (Ref. 3) Curated1
Sequence conflicti826K → Q in AAP97680 (Ref. 3) Curated1
Sequence conflicti875R → G in CAJ45483 (Ref. 2) Curated1
Sequence conflicti892L → S in CAJ45483 (Ref. 2) Curated1
Sequence conflicti1071Q → R in CAJ45483 (Ref. 2) Curated1
Sequence conflicti1167D → G in CAJ45483 (Ref. 2) Curated1
Sequence conflicti1237E → D in AAI36415 (PubMed:15489334).Curated1
Sequence conflicti1341H → N in CAJ45483 (Ref. 2) Curated1
Sequence conflicti1378 – 1379QE → HR in CAJ45483 (Ref. 2) Curated2
Sequence conflicti1429G → A in CAJ45483 (Ref. 2) Curated1
Sequence conflicti1503I → T in CAD97863 (PubMed:17974005).Curated1
Sequence conflicti1511I → T in CAD97863 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_074031352D → E in CFEOM1; de novo mutation. 1 Publication1
Natural variantiVAR_019399356M → T in CFEOM1. 2 PublicationsCorresponds to variant dbSNP:rs121912588EnsemblClinVar.1
Natural variantiVAR_074032944E → Q in CFEOM1. 1 Publication1
Natural variantiVAR_019400947M → R in CFEOM1. 1 PublicationCorresponds to variant dbSNP:rs121912590EnsemblClinVar.1
Natural variantiVAR_027021947M → T in CFEOM1. 1 Publication1
Natural variantiVAR_019401947M → V in CFEOM1. 1 PublicationCorresponds to variant dbSNP:rs121912589EnsemblClinVar.1
Natural variantiVAR_074033954R → L in CFEOM1. 1 Publication1
Natural variantiVAR_019402954R → Q in CFEOM1. 2 PublicationsCorresponds to variant dbSNP:rs121912586EnsemblClinVar.1
Natural variantiVAR_019403954R → W in CFEOM1. 2 PublicationsCorresponds to variant dbSNP:rs121912585EnsemblClinVar.1
Natural variantiVAR_0740341008A → P in CFEOM1. 1 Publication1
Natural variantiVAR_0194041010I → T in CFEOM1. 1 PublicationCorresponds to variant dbSNP:rs121912587EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_010870558 – 570Missing in isoform 2, isoform 5 and isoform 6. 7 PublicationsAdd BLAST13
Alternative sequenceiVSP_046790807 – 829Missing in isoform 6. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_0467911107 – 1113Missing in isoform 5. 1 Publication7
Alternative sequenceiVSP_0108711260 – 1319HSDSG…HRSSR → QSDESDSSLSEVH in isoform 3. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_0467921304 – 1320Missing in isoform 5 and isoform 6. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_0108721315H → HS in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY368076 mRNA Translation: AAR04774.1
AM177179 mRNA Translation: CAJ45483.1
AF450487 mRNA Translation: AAP97680.1 Frameshift.
AB290166 mRNA Translation: BAG06720.1
AC084373 Genomic DNA No translation available.
AC090668 Genomic DNA No translation available.
AC121334 Genomic DNA No translation available.
AF155117 mRNA Translation: AAD42883.1 Sequence problems.
AK000059 mRNA Translation: BAA90916.1 Sequence problems.
CH471111 Genomic DNA Translation: EAW57803.1
BC041430 mRNA Translation: AAH41430.1 Sequence problems.
BC047572 mRNA Translation: AAH47572.1
BC136414 mRNA Translation: AAI36415.1
AB051495 mRNA Translation: BAB21799.2
BX537855 mRNA Translation: CAD97863.1
CCDSiCCDS31773.1 [Q7Z4S6-2]
CCDS53774.1 [Q7Z4S6-6]
CCDS53775.1 [Q7Z4S6-5]
CCDS53776.1 [Q7Z4S6-1]
RefSeqiNP_001166934.1, NM_001173463.1 [Q7Z4S6-5]
NP_001166935.1, NM_001173464.1 [Q7Z4S6-1]
NP_001166936.1, NM_001173465.1 [Q7Z4S6-6]
NP_060111.2, NM_017641.3 [Q7Z4S6-2]
XP_005269064.1, XM_005269007.2 [Q7Z4S6-4]
XP_005269070.1, XM_005269013.2 [Q7Z4S6-3]
UniGeneiHs.374201

Genome annotation databases

EnsembliENST00000361418; ENSP00000354878; ENSG00000139116 [Q7Z4S6-1]
ENST00000361961; ENSP00000354851; ENSG00000139116 [Q7Z4S6-2]
ENST00000541463; ENSP00000438075; ENSG00000139116 [Q7Z4S6-6]
ENST00000544797; ENSP00000445606; ENSG00000139116 [Q7Z4S6-5]
GeneIDi55605
KEGGihsa:55605
UCSCiuc001rlx.4 human [Q7Z4S6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY368076 mRNA Translation: AAR04774.1
AM177179 mRNA Translation: CAJ45483.1
AF450487 mRNA Translation: AAP97680.1 Frameshift.
AB290166 mRNA Translation: BAG06720.1
AC084373 Genomic DNA No translation available.
AC090668 Genomic DNA No translation available.
AC121334 Genomic DNA No translation available.
AF155117 mRNA Translation: AAD42883.1 Sequence problems.
AK000059 mRNA Translation: BAA90916.1 Sequence problems.
CH471111 Genomic DNA Translation: EAW57803.1
BC041430 mRNA Translation: AAH41430.1 Sequence problems.
BC047572 mRNA Translation: AAH47572.1
BC136414 mRNA Translation: AAI36415.1
AB051495 mRNA Translation: BAB21799.2
BX537855 mRNA Translation: CAD97863.1
CCDSiCCDS31773.1 [Q7Z4S6-2]
CCDS53774.1 [Q7Z4S6-6]
CCDS53775.1 [Q7Z4S6-5]
CCDS53776.1 [Q7Z4S6-1]
RefSeqiNP_001166934.1, NM_001173463.1 [Q7Z4S6-5]
NP_001166935.1, NM_001173464.1 [Q7Z4S6-1]
NP_001166936.1, NM_001173465.1 [Q7Z4S6-6]
NP_060111.2, NM_017641.3 [Q7Z4S6-2]
XP_005269064.1, XM_005269007.2 [Q7Z4S6-4]
XP_005269070.1, XM_005269013.2 [Q7Z4S6-3]
UniGeneiHs.374201

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5D3AX-ray2.50A/B938-1017[»]
5NFDX-ray2.18A/B938-1017[»]
5YBUX-ray1.89B1146-1167[»]
5YBVX-ray2.12C/D1146-1167[»]
ProteinModelPortaliQ7Z4S6
SMRiQ7Z4S6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120746, 52 interactors
DIPiDIP-56253N
IntActiQ7Z4S6, 44 interactors
MINTiQ7Z4S6
STRINGi9606.ENSP00000354878

PTM databases

iPTMnetiQ7Z4S6
PhosphoSitePlusiQ7Z4S6

Polymorphism and mutation databases

BioMutaiKIF21A
DMDMi50400977

Proteomic databases

EPDiQ7Z4S6
MaxQBiQ7Z4S6
PaxDbiQ7Z4S6
PeptideAtlasiQ7Z4S6
PRIDEiQ7Z4S6
ProteomicsDBi69226
69227 [Q7Z4S6-2]
69228 [Q7Z4S6-3]
69229 [Q7Z4S6-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361418; ENSP00000354878; ENSG00000139116 [Q7Z4S6-1]
ENST00000361961; ENSP00000354851; ENSG00000139116 [Q7Z4S6-2]
ENST00000541463; ENSP00000438075; ENSG00000139116 [Q7Z4S6-6]
ENST00000544797; ENSP00000445606; ENSG00000139116 [Q7Z4S6-5]
GeneIDi55605
KEGGihsa:55605
UCSCiuc001rlx.4 human [Q7Z4S6-1]

Organism-specific databases

CTDi55605
DisGeNETi55605
EuPathDBiHostDB:ENSG00000139116.17
GeneCardsiKIF21A
GeneReviewsiKIF21A
HGNCiHGNC:19349 KIF21A
HPAiCAB022079
HPA058432
MalaCardsiKIF21A
MIMi135700 phenotype
608283 gene
neXtProtiNX_Q7Z4S6
OpenTargetsiENSG00000139116
Orphaneti45358 Congenital fibrosis of extraocular muscles
PharmGKBiPA134882934
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0244 Eukaryota
COG5059 LUCA
GeneTreeiENSGT00930000150846
HOGENOMiHOG000280728
HOVERGENiHBG052247
InParanoidiQ7Z4S6
KOiK10395
OMAiAGAQQKM
OrthoDBiEOG091G0DUL
PhylomeDBiQ7Z4S6
TreeFamiTF105224

Enzyme and pathway databases

ReactomeiR-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189 Kinesins
SignaLinkiQ7Z4S6

Miscellaneous databases

ChiTaRSiKIF21A human
GeneWikiiKIF21A
GenomeRNAii55605
PROiPR:Q7Z4S6
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000139116 Expressed in 205 organ(s), highest expression level in dorsal root ganglion
CleanExiHS_KIF21A
ExpressionAtlasiQ7Z4S6 baseline and differential
GenevisibleiQ7Z4S6 HS

Family and domain databases

Gene3Di2.130.10.10, 3 hits
3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PF00400 WD40, 4 hits
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 4 hits
PS50294 WD_REPEATS_REGION, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiKI21A_HUMAN
AccessioniPrimary (citable) accession number: Q7Z4S6
Secondary accession number(s): A8MX28
, B0I1R9, B9EGE4, F5H0C3, F5H219, Q2UVF1, Q6UKL9, Q7Z668, Q86WZ5, Q8IVZ8, Q9C0F5, Q9NXU4, Q9Y590
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: November 7, 2018
This is version 159 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again