Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SUZ domain-containing protein 1

Gene

SZRD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
SUZ domain-containing protein 1
Alternative name(s):
Putative MAPK-activating protein PM18/PM20/PM22
Gene namesi
Name:SZRD1
Synonyms:C1orf144
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000055070.16
HGNCiHGNC:30232 SZRD1
neXtProtiNX_Q7Z422

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000055070
PharmGKBiPA142672461

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003030681 – 152SUZ domain-containing protein 1Add BLAST152

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei37PhosphoserineCombined sources1
Modified residuei39PhosphoserineCombined sources1
Modified residuei51PhosphoserineCombined sources1
Modified residuei105PhosphoserineCombined sources1
Modified residuei107PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ7Z422
MaxQBiQ7Z422
PaxDbiQ7Z422
PeptideAtlasiQ7Z422
PRIDEiQ7Z422
ProteomicsDBi69131
69132 [Q7Z422-2]
69133 [Q7Z422-3]
69134 [Q7Z422-4]
TopDownProteomicsiQ7Z422-1 [Q7Z422-1]
Q7Z422-2 [Q7Z422-2]
Q7Z422-3 [Q7Z422-3]
Q7Z422-4 [Q7Z422-4]

PTM databases

iPTMnetiQ7Z422
PhosphoSitePlusiQ7Z422

Expressioni

Gene expression databases

BgeeiENSG00000055070 Expressed in 234 organ(s), highest expression level in tibial artery
CleanExiHS_C1orf144
ExpressionAtlasiQ7Z422 baseline and differential
GenevisibleiQ7Z422 HS

Organism-specific databases

HPAiHPA024221

Interactioni

Protein-protein interaction databases

BioGridi117549, 14 interactors
IntActiQ7Z422, 3 interactors
STRINGi9606.ENSP00000383866

Structurei

3D structure databases

ProteinModelPortaliQ7Z422
SMRiQ7Z422
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini42 – 107SUZPROSITE-ProRule annotationAdd BLAST66

Sequence similaritiesi

Belongs to the SZRD1 family.Curated

Phylogenomic databases

eggNOGiENOG410IG3N Eukaryota
ENOG4111N0B LUCA
GeneTreeiENSGT00390000005532
HOGENOMiHOG000231189
HOVERGENiHBG057301
InParanoidiQ7Z422
OMAiTSGFRLC
OrthoDBiEOG091G18Z5
PhylomeDBiQ7Z422
TreeFamiTF324643

Family and domain databases

InterProiView protein in InterPro
IPR024771 SUZ
IPR024642 SUZ-C
IPR039228 SZRD1
PANTHERiPTHR31796 PTHR31796, 1 hit
PfamiView protein in Pfam
PF12752 SUZ, 1 hit
PF12901 SUZ-C, 1 hit
PROSITEiView protein in PROSITE
PS51673 SUZ, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z422-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEDEEVAESW EEAADSGEID RRLEKKLKIT QKESRKSKSP PKVPIVIQDD
60 70 80 90 100
SLPAGPPPQI RILKRPTSNG VVSSPNSTSR PTLPVKSLAQ REAEYAEARK
110 120 130 140 150
RILGSASPEE EQEKPILDRP TRISQPEDSR QPNNVIRQPL GPDGSQGFKQ

RR
Length:152
Mass (Da):16,997
Last modified:October 1, 2003 - v1
Checksum:i07F735690D669778
GO
Isoform 2 (identifier: Q7Z422-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MEDEEVAESWEEAADSGEIDRRLEKKLKITQKESR → MRRSLRAGKRRQTAG

Show »
Length:132
Mass (Da):14,605
Checksum:i09739EF3FA39D8CD
GO
Isoform 3 (identifier: Q7Z422-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     18-35: Missing.

Note: No experimental confirmation available.
Show »
Length:134
Mass (Da):14,744
Checksum:iCAC73453FE73D851
GO
Isoform 4 (identifier: Q7Z422-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MEDEEVAESWEEAADSGEIDRRLEKKLKITQKES → MRRSLRAGKRRQTAG

Show »
Length:133
Mass (Da):14,761
Checksum:i5DE84B0CC8611759
GO
Isoform 5 (identifier: Q7Z422-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-34: Missing.

Note: No experimental confirmation available. Derived from EST data.
Show »
Length:151
Mass (Da):16,910
Checksum:iE60DFB37FDB93EB0
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WDF4F8WDF4_HUMAN
SUZ domain-containing protein 1
SZRD1
84Annotation score:

Sequence cautioni

The sequence CAB43245 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAC82500 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0279951 – 35MEDEE…QKESR → MRRSLRAGKRRQTAG in isoform 2. 2 PublicationsAdd BLAST35
Alternative sequenceiVSP_0279961 – 34MEDEE…TQKES → MRRSLRAGKRRQTAG in isoform 4. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_02799718 – 35Missing in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_05569034Missing in isoform 5. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB097042 mRNA Translation: BAC77395.1
AB097044 mRNA Translation: BAC77397.1
AB097046 mRNA Translation: BAC77399.1
AJ295987 mRNA Translation: CAC82500.1 Different initiation.
AL050028 mRNA Translation: CAB43245.1 Different initiation.
AL358794 Genomic DNA No translation available.
BC023988 mRNA Translation: AAH23988.1
BC065538 mRNA Translation: AAH65538.1
CCDSiCCDS44065.1 [Q7Z422-1]
CCDS60000.1 [Q7Z422-5]
PIRiT08712
RefSeqiNP_001108072.1, NM_001114600.2 [Q7Z422-1]
NP_001258798.1, NM_001271869.1 [Q7Z422-5]
UniGeneiHs.252967

Genome annotation databases

EnsembliENST00000401088; ENSP00000383866; ENSG00000055070 [Q7Z422-1]
ENST00000401089; ENSP00000383867; ENSG00000055070 [Q7Z422-4]
ENST00000471507; ENSP00000419589; ENSG00000055070 [Q7Z422-5]
ENST00000492354; ENSP00000418012; ENSG00000055070 [Q7Z422-2]
GeneIDi26099
KEGGihsa:26099
UCSCiuc001ayi.6 human [Q7Z422-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB097042 mRNA Translation: BAC77395.1
AB097044 mRNA Translation: BAC77397.1
AB097046 mRNA Translation: BAC77399.1
AJ295987 mRNA Translation: CAC82500.1 Different initiation.
AL050028 mRNA Translation: CAB43245.1 Different initiation.
AL358794 Genomic DNA No translation available.
BC023988 mRNA Translation: AAH23988.1
BC065538 mRNA Translation: AAH65538.1
CCDSiCCDS44065.1 [Q7Z422-1]
CCDS60000.1 [Q7Z422-5]
PIRiT08712
RefSeqiNP_001108072.1, NM_001114600.2 [Q7Z422-1]
NP_001258798.1, NM_001271869.1 [Q7Z422-5]
UniGeneiHs.252967

3D structure databases

ProteinModelPortaliQ7Z422
SMRiQ7Z422
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117549, 14 interactors
IntActiQ7Z422, 3 interactors
STRINGi9606.ENSP00000383866

PTM databases

iPTMnetiQ7Z422
PhosphoSitePlusiQ7Z422

Proteomic databases

EPDiQ7Z422
MaxQBiQ7Z422
PaxDbiQ7Z422
PeptideAtlasiQ7Z422
PRIDEiQ7Z422
ProteomicsDBi69131
69132 [Q7Z422-2]
69133 [Q7Z422-3]
69134 [Q7Z422-4]
TopDownProteomicsiQ7Z422-1 [Q7Z422-1]
Q7Z422-2 [Q7Z422-2]
Q7Z422-3 [Q7Z422-3]
Q7Z422-4 [Q7Z422-4]

Protocols and materials databases

DNASUi26099
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000401088; ENSP00000383866; ENSG00000055070 [Q7Z422-1]
ENST00000401089; ENSP00000383867; ENSG00000055070 [Q7Z422-4]
ENST00000471507; ENSP00000419589; ENSG00000055070 [Q7Z422-5]
ENST00000492354; ENSP00000418012; ENSG00000055070 [Q7Z422-2]
GeneIDi26099
KEGGihsa:26099
UCSCiuc001ayi.6 human [Q7Z422-1]

Organism-specific databases

CTDi26099
EuPathDBiHostDB:ENSG00000055070.16
GeneCardsiSZRD1
HGNCiHGNC:30232 SZRD1
HPAiHPA024221
neXtProtiNX_Q7Z422
OpenTargetsiENSG00000055070
PharmGKBiPA142672461
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IG3N Eukaryota
ENOG4111N0B LUCA
GeneTreeiENSGT00390000005532
HOGENOMiHOG000231189
HOVERGENiHBG057301
InParanoidiQ7Z422
OMAiTSGFRLC
OrthoDBiEOG091G18Z5
PhylomeDBiQ7Z422
TreeFamiTF324643

Miscellaneous databases

ChiTaRSiSZRD1 human
GenomeRNAii26099
PROiPR:Q7Z422

Gene expression databases

BgeeiENSG00000055070 Expressed in 234 organ(s), highest expression level in tibial artery
CleanExiHS_C1orf144
ExpressionAtlasiQ7Z422 baseline and differential
GenevisibleiQ7Z422 HS

Family and domain databases

InterProiView protein in InterPro
IPR024771 SUZ
IPR024642 SUZ-C
IPR039228 SZRD1
PANTHERiPTHR31796 PTHR31796, 1 hit
PfamiView protein in Pfam
PF12752 SUZ, 1 hit
PF12901 SUZ-C, 1 hit
PROSITEiView protein in PROSITE
PS51673 SUZ, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSZRD1_HUMAN
AccessioniPrimary (citable) accession number: Q7Z422
Secondary accession number(s): A8MXJ2
, C9K0U0, Q7Z424, Q8IVM2, Q8TBV3, Q9Y403
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: October 1, 2003
Last modified: September 12, 2018
This is version 115 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again