Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 104 (05 Jun 2019)
Sequence version 2 (13 Nov 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

VPS35 endosomal protein sorting factor-like

Gene

VPS35L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as component of the retriever complex. The retriever complex is a heterotrimeric complex related to retromer cargo-selective complex (CSC) and essential for retromer-independent retrieval and recycling of numerous cargos such as integrin alpha-5/beta-1 (ITGA5:ITGB1) (PubMed:28892079). The recruitment of the retriever complex to the endosomal membrane involves CCC and WASH complexes (PubMed:28892079). In the endosomes, drives the retrieval and recycling of NxxY-motif-containing cargo proteins by coupling to SNX17, a cargo essential for the homeostatic maintenance of numerous cell suface proteins associated with processes that include cell migration, cell adhesion, nutrient supply and cell signaling (PubMed:28892079). Involved in copper-dependent ATP7A trafficking between the trans-Golgi network and vesicles in the cell periphery; the function is proposed to depend on its association with the CCC complex and cooperation with the WASH complex on early endosomes. Seems not to be required for CCC complex stability (PubMed:25355947).2 Publications
(Microbial infection) The heterotrimeric retriever complex, in collaboration with the CCC complex, mediates the exit of human papillomavirus to the cell surface.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6798695 Neutrophil degranulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
VPS35 endosomal protein sorting factor-likeCurated
Alternative name(s):
Esophageal cancer-associated protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:VPS35LImported
Synonyms:C16orf62Imported
ORF Names:101F10.2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24641 VPS35L

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7Z3J2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei703 – 719HelicalSequence analysisAdd BLAST17

Keywords - Cellular componenti

Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000103544

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162378300

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
C16orf62

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003113521 – 963VPS35 endosomal protein sorting factor-likeAdd BLAST963

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei265PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7Z3J2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q7Z3J2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q7Z3J2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7Z3J2

PeptideAtlas

More...
PeptideAtlasi
Q7Z3J2

PRoteomics IDEntifications database

More...
PRIDEi
Q7Z3J2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
69055
69056 [Q7Z3J2-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7Z3J2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7Z3J2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000103544 Expressed in 224 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7Z3J2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7Z3J2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA042969
HPA053547

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the heterotrimeric retriever complex formed by VPS26C, VPS29 and VPS35L (PubMed:28892079). Interacts with COMMD1, CCDC93 and CCDC22; associates with the CCC (COMMD/CCDC22/CCDC93) complex which contains at least COMMD1 (and possibly other COMM domain-containing proteins), CCDC22 and CCDC93 (PubMed:25355947, PubMed:28892079). Interacts with WASHC1, WASHC2A and WASHC2C (PubMed:25355947). Interacts with SNX17 and SNX31 (PubMed:28892079).2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121329, 21 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q7Z3J2

Protein interaction database and analysis system

More...
IntActi
Q7Z3J2, 6 interactors

Molecular INTeraction database

More...
MINTi
Q7Z3J2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000251143

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7Z3J2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi53 – 71Ser-richAdd BLAST19

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the VPS35L family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3682 Eukaryota
ENOG410XQR5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000011343

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7Z3J2

Database of Orthologous Groups

More...
OrthoDBi
247677at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7Z3J2

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029705 VPS35L

The PANTHER Classification System

More...
PANTHERi
PTHR13673 PTHR13673, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z3J2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAVFPWHSRN RNYKAEFASC RLEAVPLEFG DYHPLKPITV TESKTKKVNR
60 70 80 90 100
KGSTSSTSSS SSSSVVDPLS SVLDGTDPLS MFAATADPAA LAAAMDSSRR
110 120 130 140 150
KRDRDDNSVV GSDFEPWTNK RGEILARYTT TEKLSINLFM GSEKGKAGTA
160 170 180 190 200
TLAMSEKVRT RLEELDDFEE GSQKELLNLT QQDYVNRIEE LNQSLKDAWA
210 220 230 240 250
SDQKVKALKI VIQCSKLLSD TSVIQFYPSK FVLITDILDT FGKLVYERIF
260 270 280 290 300
SMCVDSRSVL PDHFSPENAN DTAKETCLNW FFKIASIREL IPRFYVEASI
310 320 330 340 350
LKCNKFLSKT GISECLPRLT CMIRGIGDPL VSVYARAYLC RVGMEVAPHL
360 370 380 390 400
KETLNKNFFD FLLTFKQIHG DTVQNQLVVQ GVELPSYLPL YPPAMDWIFQ
410 420 430 440 450
CISYHAPEAL LTEMMERCKK LGNNALLLNS VMSAFRAEFI ATRSMDFIGM
460 470 480 490 500
IKECDESGFP KHLLFRSLGL NLALADPPES DRLQILNEAW KVITKLKNPQ
510 520 530 540 550
DYINCAEVWV EYTCKHFTKR EVNTVLADVI KHMTPDRAFE DSYPQLQLII
560 570 580 590 600
KKVIAHFHDF SVLFSVEKFL PFLDMFQKES VRVEVCKCIM DAFIKHQQEP
610 620 630 640 650
TKDPVILNAL LHVCKTMHDS VNALTLEDEK RMLSYLINGF IKMVSFGRDF
660 670 680 690 700
EQQLSFYVES RSMFCNLEPV LVQLIHSVNR LAMETRKVMK GNHSRKTAAF
710 720 730 740 750
VRACVAYCFI TIPSLAGIFT RLNLYLHSGQ VALANQCLSQ ADAFFKAAIS
760 770 780 790 800
LVPEVPKMIN IDGKMRPSES FLLEFLCNFF STLLIVPDHP EHGVLFLVRE
810 820 830 840 850
LLNVIQDYTW EDNSDEKIRI YTCVLHLLSA MSQETYLYHI DKVDSNDSLY
860 870 880 890 900
GGDSKFLAEN NKLCETVMAQ ILEHLKTLAK DEALKRQSSL GLSFFNSILA
910 920 930 940 950
HGDLRNNKLN QLSVNLWHLA QRHGCADTRT MVKTLEYIKK QSKQPDMTHL
960
TELALRLPLQ TRT
Length:963
Mass (Da):109,563
Last modified:November 13, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5500471390F85683
GO
Isoform 2 (identifier: Q7Z3J2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-122: Missing.
     123-144: EILARYTTTEKLSINLFMGSEK → MPPLGVLVHEKSHLCDVNSFCL
     214-243: CSKLLSDTSVIQFYPSKFVLITDILDTFGK → EE

Show »
Length:813
Mass (Da):93,086
Checksum:iD5D3817BDA5B0129
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EWW0E7EWW0_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
1,052Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H7K1F5H7K1_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
959Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6S1J4F6S1J4_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
273Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BVG8H3BVG8_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
451Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BNX2H3BNX2_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
168Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BV68H3BV68_HUMAN
Esophageal cancer associated protei...
VPS35L MGC16824, hCG_1993553
712Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BRV8H3BRV8_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J7I2C9J7I2_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
813Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L1U5I3L1U5_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BTI5H3BTI5_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH14900 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAD97869 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti168F → S in CAH10399 (PubMed:17974005).Curated1
Sequence conflicti340C → G in AAL67806 (Ref. 1) Curated1
Sequence conflicti675I → V in CAD97869 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03723032Y → C1 PublicationCorresponds to variant dbSNP:rs17854969Ensembl.1
Natural variantiVAR_037231186N → I. Corresponds to variant dbSNP:rs7206637Ensembl.1
Natural variantiVAR_037232506A → V1 PublicationCorresponds to variant dbSNP:rs17854970Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0295361 – 122Missing in isoform 2. 1 PublicationAdd BLAST122
Alternative sequenceiVSP_029537123 – 144EILAR…MGSEK → MPPLGVLVHEKSHLCDVNSF CL in isoform 2. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_029538214 – 243CSKLL…DTFGK → EE in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF461052 mRNA Translation: AAL67806.2
AK024693 mRNA Translation: BAB14965.1
AK290286 mRNA Translation: BAF82975.1
BX537867 mRNA Translation: CAD97869.1 Different initiation.
AL833428 mRNA Translation: CAH10399.1
BC014900 mRNA Translation: AAH14900.2 Different initiation.
BC050464 mRNA Translation: AAH50464.1
BC058845 mRNA Translation: AAH58845.1
AL136744 mRNA Translation: CAB66678.1
AC002550 Genomic DNA Translation: AAC05806.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32397.2 [Q7Z3J2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_064710.4, NM_020314.5 [Q7Z3J2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000417362; ENSP00000395973; ENSG00000103544 [Q7Z3J2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57020

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57020

UCSC genome browser

More...
UCSCi
uc059rnn.1 human [Q7Z3J2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF461052 mRNA Translation: AAL67806.2
AK024693 mRNA Translation: BAB14965.1
AK290286 mRNA Translation: BAF82975.1
BX537867 mRNA Translation: CAD97869.1 Different initiation.
AL833428 mRNA Translation: CAH10399.1
BC014900 mRNA Translation: AAH14900.2 Different initiation.
BC050464 mRNA Translation: AAH50464.1
BC058845 mRNA Translation: AAH58845.1
AL136744 mRNA Translation: CAB66678.1
AC002550 Genomic DNA Translation: AAC05806.1
CCDSiCCDS32397.2 [Q7Z3J2-1]
RefSeqiNP_064710.4, NM_020314.5 [Q7Z3J2-1]

3D structure databases

SMRiQ7Z3J2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121329, 21 interactors
CORUMiQ7Z3J2
IntActiQ7Z3J2, 6 interactors
MINTiQ7Z3J2
STRINGi9606.ENSP00000251143

PTM databases

iPTMnetiQ7Z3J2
PhosphoSitePlusiQ7Z3J2

Polymorphism and mutation databases

BioMutaiC16orf62

Proteomic databases

EPDiQ7Z3J2
jPOSTiQ7Z3J2
MaxQBiQ7Z3J2
PaxDbiQ7Z3J2
PeptideAtlasiQ7Z3J2
PRIDEiQ7Z3J2
ProteomicsDBi69055
69056 [Q7Z3J2-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
57020
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000417362; ENSP00000395973; ENSG00000103544 [Q7Z3J2-1]
GeneIDi57020
KEGGihsa:57020
UCSCiuc059rnn.1 human [Q7Z3J2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57020

GeneCards: human genes, protein and diseases

More...
GeneCardsi
VPS35L

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0022848
HGNCiHGNC:24641 VPS35L
HPAiHPA042969
HPA053547
neXtProtiNX_Q7Z3J2
OpenTargetsiENSG00000103544
PharmGKBiPA162378300

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3682 Eukaryota
ENOG410XQR5 LUCA
GeneTreeiENSGT00390000011343
InParanoidiQ7Z3J2
OrthoDBi247677at2759
PhylomeDBiQ7Z3J2

Enzyme and pathway databases

ReactomeiR-HSA-6798695 Neutrophil degranulation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
C16orf62 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57020

Protein Ontology

More...
PROi
PR:Q7Z3J2

Gene expression databases

BgeeiENSG00000103544 Expressed in 224 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ7Z3J2 baseline and differential
GenevisibleiQ7Z3J2 HS

Family and domain databases

InterProiView protein in InterPro
IPR029705 VPS35L
PANTHERiPTHR13673 PTHR13673, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVP35L_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7Z3J2
Secondary accession number(s): A8K2M1
, O43329, Q69YI1, Q6PDA0, Q7L371, Q86W66, Q8WXA5, Q9H0L7, Q9H7C8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: June 5, 2019
This is version 104 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries
  3. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again