Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UPF0505 protein C16orf62

Gene

C16orf62

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in copper-dependent ATP7A trafficking between the trans-Golgi network and vesicles in the cell periphery; the function is proposed to depend on its association within the CCC complex and cooperation with the WASH complex on early endosomes. Seems not to be required for CCC complex stability (PubMed:25355947).1 Publication

GO - Biological processi

  • Golgi to plasma membrane transport Source: UniProtKB
  • neutrophil degranulation Source: Reactome
  • protein transport Source: UniProtKB-KW

Keywordsi

Biological processProtein transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-6798695 Neutrophil degranulation

Names & Taxonomyi

Protein namesi
Recommended name:
UPF0505 protein C16orf62
Alternative name(s):
Esophageal cancer-associated protein
Gene namesi
ORF Names:101F10.2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000103544.14
HGNCiHGNC:24641 C16orf62
neXtProtiNX_Q7Z3J2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei703 – 719HelicalSequence analysisAdd BLAST17

Keywords - Cellular componenti

Endosome, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000103544
PharmGKBiPA162378300

Polymorphism and mutation databases

BioMutaiC16orf62

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003113521 – 963UPF0505 protein C16orf62Add BLAST963

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei265PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ7Z3J2
MaxQBiQ7Z3J2
PaxDbiQ7Z3J2
PeptideAtlasiQ7Z3J2
PRIDEiQ7Z3J2
ProteomicsDBi69055
69056 [Q7Z3J2-2]

PTM databases

iPTMnetiQ7Z3J2
PhosphoSitePlusiQ7Z3J2

Expressioni

Gene expression databases

BgeeiENSG00000103544 Expressed in 224 organ(s), highest expression level in corpus callosum
CleanExiHS_C16orf62
ExpressionAtlasiQ7Z3J2 baseline and differential
GenevisibleiQ7Z3J2 HS

Organism-specific databases

HPAiHPA042969
HPA053547

Interactioni

Subunit structurei

Interacts with COMMD1, CCDC93 and CCDC22; proposed to be a component of the CCC (COMMD/CCDC22/CCDC93) complex which contains at least COMMD1 (and possibly other COMM domain-containing proteins), CCDC22, CCDC93 and C16orf62. Interacts with WASHC1 and WASHC2C (PubMed:25355947).1 Publication1 Publication

Protein-protein interaction databases

BioGridi121329, 20 interactors
CORUMiQ7Z3J2
IntActiQ7Z3J2, 3 interactors
STRINGi9606.ENSP00000400815

Structurei

3D structure databases

ProteinModelPortaliQ7Z3J2
SMRiQ7Z3J2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi53 – 71Ser-richAdd BLAST19

Sequence similaritiesi

Belongs to the UPF0505 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3682 Eukaryota
ENOG410XQR5 LUCA
GeneTreeiENSGT00390000011343
HOVERGENiHBG107748
InParanoidiQ7Z3J2
PhylomeDBiQ7Z3J2

Family and domain databases

InterProiView protein in InterPro
IPR029705 UPF0505
PANTHERiPTHR13673 PTHR13673, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z3J2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAVFPWHSRN RNYKAEFASC RLEAVPLEFG DYHPLKPITV TESKTKKVNR
60 70 80 90 100
KGSTSSTSSS SSSSVVDPLS SVLDGTDPLS MFAATADPAA LAAAMDSSRR
110 120 130 140 150
KRDRDDNSVV GSDFEPWTNK RGEILARYTT TEKLSINLFM GSEKGKAGTA
160 170 180 190 200
TLAMSEKVRT RLEELDDFEE GSQKELLNLT QQDYVNRIEE LNQSLKDAWA
210 220 230 240 250
SDQKVKALKI VIQCSKLLSD TSVIQFYPSK FVLITDILDT FGKLVYERIF
260 270 280 290 300
SMCVDSRSVL PDHFSPENAN DTAKETCLNW FFKIASIREL IPRFYVEASI
310 320 330 340 350
LKCNKFLSKT GISECLPRLT CMIRGIGDPL VSVYARAYLC RVGMEVAPHL
360 370 380 390 400
KETLNKNFFD FLLTFKQIHG DTVQNQLVVQ GVELPSYLPL YPPAMDWIFQ
410 420 430 440 450
CISYHAPEAL LTEMMERCKK LGNNALLLNS VMSAFRAEFI ATRSMDFIGM
460 470 480 490 500
IKECDESGFP KHLLFRSLGL NLALADPPES DRLQILNEAW KVITKLKNPQ
510 520 530 540 550
DYINCAEVWV EYTCKHFTKR EVNTVLADVI KHMTPDRAFE DSYPQLQLII
560 570 580 590 600
KKVIAHFHDF SVLFSVEKFL PFLDMFQKES VRVEVCKCIM DAFIKHQQEP
610 620 630 640 650
TKDPVILNAL LHVCKTMHDS VNALTLEDEK RMLSYLINGF IKMVSFGRDF
660 670 680 690 700
EQQLSFYVES RSMFCNLEPV LVQLIHSVNR LAMETRKVMK GNHSRKTAAF
710 720 730 740 750
VRACVAYCFI TIPSLAGIFT RLNLYLHSGQ VALANQCLSQ ADAFFKAAIS
760 770 780 790 800
LVPEVPKMIN IDGKMRPSES FLLEFLCNFF STLLIVPDHP EHGVLFLVRE
810 820 830 840 850
LLNVIQDYTW EDNSDEKIRI YTCVLHLLSA MSQETYLYHI DKVDSNDSLY
860 870 880 890 900
GGDSKFLAEN NKLCETVMAQ ILEHLKTLAK DEALKRQSSL GLSFFNSILA
910 920 930 940 950
HGDLRNNKLN QLSVNLWHLA QRHGCADTRT MVKTLEYIKK QSKQPDMTHL
960
TELALRLPLQ TRT
Length:963
Mass (Da):109,563
Last modified:November 13, 2007 - v2
Checksum:i5500471390F85683
GO
Isoform 2 (identifier: Q7Z3J2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-122: Missing.
     123-144: EILARYTTTEKLSINLFMGSEK → MPPLGVLVHEKSHLCDVNSFCL
     214-243: CSKLLSDTSVIQFYPSKFVLITDILDTFGK → EE

Show »
Length:813
Mass (Da):93,086
Checksum:iD5D3817BDA5B0129
GO

Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BV68H3BV68_HUMAN
Esophageal cancer associated protei...
VPS35L MGC16824, hCG_1993553
712Annotation score:
E7EWW0E7EWW0_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
1,052Annotation score:
F5H7K1F5H7K1_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
959Annotation score:
C9J7I2C9J7I2_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
813Annotation score:
H3BRV8H3BRV8_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
95Annotation score:
I3L1U5I3L1U5_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
95Annotation score:
F6S1J4F6S1J4_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
273Annotation score:
H3BTI5H3BTI5_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
73Annotation score:
H3BNX2H3BNX2_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
168Annotation score:
H3BVG8H3BVG8_HUMAN
VPS35 endosomal protein sorting fac...
VPS35L
451Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence AAH14900 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAD97869 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti168F → S in CAH10399 (PubMed:17974005).Curated1
Sequence conflicti340C → G in AAL67806 (Ref. 1) Curated1
Sequence conflicti675I → V in CAD97869 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03723032Y → C1 PublicationCorresponds to variant dbSNP:rs17854969Ensembl.1
Natural variantiVAR_037231186N → I. Corresponds to variant dbSNP:rs7206637Ensembl.1
Natural variantiVAR_037232506A → V1 PublicationCorresponds to variant dbSNP:rs17854970Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0295361 – 122Missing in isoform 2. 1 PublicationAdd BLAST122
Alternative sequenceiVSP_029537123 – 144EILAR…MGSEK → MPPLGVLVHEKSHLCDVNSF CL in isoform 2. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_029538214 – 243CSKLL…DTFGK → EE in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF461052 mRNA Translation: AAL67806.2
AK024693 mRNA Translation: BAB14965.1
AK290286 mRNA Translation: BAF82975.1
BX537867 mRNA Translation: CAD97869.1 Different initiation.
AL833428 mRNA Translation: CAH10399.1
BC014900 mRNA Translation: AAH14900.2 Different initiation.
BC050464 mRNA Translation: AAH50464.1
BC058845 mRNA Translation: AAH58845.1
AL136744 mRNA Translation: CAB66678.1
AC002550 Genomic DNA Translation: AAC05806.1
CCDSiCCDS32397.2 [Q7Z3J2-1]
RefSeqiNP_064710.4, NM_020314.5
UniGeneiHs.654964

Genome annotation databases

EnsembliENST00000417362; ENSP00000395973; ENSG00000103544 [Q7Z3J2-1]
GeneIDi57020
KEGGihsa:57020
UCSCiuc059rnn.1 human [Q7Z3J2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF461052 mRNA Translation: AAL67806.2
AK024693 mRNA Translation: BAB14965.1
AK290286 mRNA Translation: BAF82975.1
BX537867 mRNA Translation: CAD97869.1 Different initiation.
AL833428 mRNA Translation: CAH10399.1
BC014900 mRNA Translation: AAH14900.2 Different initiation.
BC050464 mRNA Translation: AAH50464.1
BC058845 mRNA Translation: AAH58845.1
AL136744 mRNA Translation: CAB66678.1
AC002550 Genomic DNA Translation: AAC05806.1
CCDSiCCDS32397.2 [Q7Z3J2-1]
RefSeqiNP_064710.4, NM_020314.5
UniGeneiHs.654964

3D structure databases

ProteinModelPortaliQ7Z3J2
SMRiQ7Z3J2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121329, 20 interactors
CORUMiQ7Z3J2
IntActiQ7Z3J2, 3 interactors
STRINGi9606.ENSP00000400815

PTM databases

iPTMnetiQ7Z3J2
PhosphoSitePlusiQ7Z3J2

Polymorphism and mutation databases

BioMutaiC16orf62

Proteomic databases

EPDiQ7Z3J2
MaxQBiQ7Z3J2
PaxDbiQ7Z3J2
PeptideAtlasiQ7Z3J2
PRIDEiQ7Z3J2
ProteomicsDBi69055
69056 [Q7Z3J2-2]

Protocols and materials databases

DNASUi57020
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000417362; ENSP00000395973; ENSG00000103544 [Q7Z3J2-1]
GeneIDi57020
KEGGihsa:57020
UCSCiuc059rnn.1 human [Q7Z3J2-1]

Organism-specific databases

CTDi57020
EuPathDBiHostDB:ENSG00000103544.14
GeneCardsiVPS35L
H-InvDBiHIX0022848
HGNCiHGNC:24641 C16orf62
HPAiHPA042969
HPA053547
neXtProtiNX_Q7Z3J2
OpenTargetsiENSG00000103544
PharmGKBiPA162378300
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3682 Eukaryota
ENOG410XQR5 LUCA
GeneTreeiENSGT00390000011343
HOVERGENiHBG107748
InParanoidiQ7Z3J2
PhylomeDBiQ7Z3J2

Enzyme and pathway databases

ReactomeiR-HSA-6798695 Neutrophil degranulation

Miscellaneous databases

ChiTaRSiC16orf62 human
GenomeRNAii57020
PROiPR:Q7Z3J2

Gene expression databases

BgeeiENSG00000103544 Expressed in 224 organ(s), highest expression level in corpus callosum
CleanExiHS_C16orf62
ExpressionAtlasiQ7Z3J2 baseline and differential
GenevisibleiQ7Z3J2 HS

Family and domain databases

InterProiView protein in InterPro
IPR029705 UPF0505
PANTHERiPTHR13673 PTHR13673, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCP062_HUMAN
AccessioniPrimary (citable) accession number: Q7Z3J2
Secondary accession number(s): A8K2M1
, O43329, Q69YI1, Q6PDA0, Q7L371, Q86W66, Q8WXA5, Q9H0L7, Q9H7C8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: November 7, 2018
This is version 98 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again