Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM122B

Gene

FAM122B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein FAM122B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FAM122B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000156504.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30490 FAM122B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7Z309

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000156504

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA128394763

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FAM122B

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002545452 – 247Protein FAM122BAdd BLAST246

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei25PhosphoserineCombined sources1
Modified residuei33PhosphoserineCombined sources1
Modified residuei50PhosphoserineCombined sources1
Modified residuei58PhosphoserineCombined sources1
Modified residuei112PhosphothreonineCombined sources1
Modified residuei115PhosphoserineCombined sources1
Modified residuei119PhosphoserineCombined sources1
Modified residuei122Omega-N-methylarginineCombined sources1
Modified residuei137PhosphoserineCombined sources1
Modified residuei141PhosphoserineCombined sources1
Isoform 3 (identifier: Q7Z309-3)
Modified residuei63PhosphoserineCombined sources1
Isoform 4 (identifier: Q7Z309-4)
Modified residuei63PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform 3 and isoform 4 are phosphorylated on Ser-62 and Ser-64.

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7Z309

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q7Z309

PeptideAtlas

More...
PeptideAtlasi
Q7Z309

PRoteomics IDEntifications database

More...
PRIDEi
Q7Z309

ProteomicsDB human proteome resource

More...
ProteomicsDBi
68995
68996 [Q7Z309-2]
68997 [Q7Z309-3]
68998 [Q7Z309-4]
68999 [Q7Z309-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7Z309

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7Z309

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000156504 Expressed in 204 organ(s), highest expression level in epithelial cell of pancreas

CleanEx database of gene expression profiles

More...
CleanExi
HS_FAM122B

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7Z309 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7Z309 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA000266

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
127730, 21 interactors

Protein interaction database and analysis system

More...
IntActi
Q7Z309, 7 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q7Z309

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7Z309

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi195 – 237Ser-richAdd BLAST43

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM122 family.Curated

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000015476

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG073694

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7Z309

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7Z309

TreeFam database of animal gene trees

More...
TreeFami
TF330808

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026716 FAM122

The PANTHER Classification System

More...
PANTHERi
PTHR22227 PTHR22227, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z309-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQEKMELDL EPDTSYGGTL RRSSSAPLIH GLSDLSQVFQ PYTLRTRRNS
60 70 80 90 100
TTIMSRHSLE EGLDMVNRET AHEREMQTAM QISQSWDESL SLSDSDFDKP
110 120 130 140 150
EKLYSPKRID FTPVSPAPSP TRGFGKMFVS SSGLPPSPVP SPRRFSRRSQ
160 170 180 190 200
SPVKCIRPSV LGPLKRKGEM ETESQPKRLF QGTTNMLSPD AAQLSDLSSC
210 220 230 240
SDILDGSSSS SGLSSDPLAK GSATAESPVA CSNSCSSFIL MDDLSPK
Length:247
Mass (Da):26,928
Last modified:October 31, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDB1B5C725E619EA2
GO
Isoform 2 (identifier: Q7Z309-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-146: S → SS

Show »
Length:248
Mass (Da):27,015
Checksum:i8FF98300C767DD42
GO
Isoform 3 (identifier: Q7Z309-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: L → LLLSSSPNRIPSSRLHQIKR

Show »
Length:266
Mass (Da):29,100
Checksum:i82C27D3CE84CB16C
GO
Isoform 4 (identifier: Q7Z309-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: L → LLLSSSPNRIPSSRLHQIKR
     200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

Show »
Length:241
Mass (Da):27,210
Checksum:i9EBC46BA19CC0FA5
GO
Isoform 5 (identifier: Q7Z309-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     146-146: S → SS
     200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

Note: No experimental confirmation available.
Show »
Length:170
Mass (Da):19,174
Checksum:i4771FC7887AC30C2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G1UD79G1UD79_HUMAN
Protein FAM122B
FAM122B RP11-308B5.5, SPACIA2, hCG_15414
267Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH32419 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0212151 – 53Missing in isoform 5. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_02121659L → LLLSSSPNRIPSSRLHQIKR in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_021217146S → SS in isoform 2 and isoform 5. 2 Publications1
Alternative sequenceiVSP_021218200 – 247CSDIL…DLSPK → WWCYQGEEIPALTRCVEHLQ MNE in isoform 4 and isoform 5. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK124650 mRNA Translation: BAC85918.1
AK124940 mRNA Translation: BAC85999.1
AK125991 mRNA Translation: BAC86380.1
AK292517 mRNA Translation: BAF85206.1
BX538218 mRNA Translation: CAD98073.1
AL672032 Genomic DNA No translation available.
AL691477 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11751.1
BC019221 mRNA Translation: AAH19221.1
BC032419 mRNA Translation: AAH32419.1 Different initiation.
BC110846 mRNA Translation: AAI10847.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14643.1 [Q7Z309-2]
CCDS55497.1 [Q7Z309-1]
CCDS55498.1 [Q7Z309-4]
CCDS55499.1 [Q7Z309-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001160071.1, NM_001166599.3 [Q7Z309-1]
NP_001160072.1, NM_001166600.2 [Q7Z309-4]
NP_001164227.1, NM_001170756.1 [Q7Z309-3]
NP_001164228.1, NM_001170757.1
NP_660327.2, NM_145284.5 [Q7Z309-2]
XP_011529595.1, XM_011531293.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.404706

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000298090; ENSP00000298090; ENSG00000156504 [Q7Z309-4]
ENST00000370790; ENSP00000359826; ENSG00000156504 [Q7Z309-1]
ENST00000486347; ENSP00000419592; ENSG00000156504 [Q7Z309-2]
ENST00000493333; ENSP00000487221; ENSG00000156504 [Q7Z309-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
159090

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:159090

UCSC genome browser

More...
UCSCi
uc004exr.4 human [Q7Z309-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK124650 mRNA Translation: BAC85918.1
AK124940 mRNA Translation: BAC85999.1
AK125991 mRNA Translation: BAC86380.1
AK292517 mRNA Translation: BAF85206.1
BX538218 mRNA Translation: CAD98073.1
AL672032 Genomic DNA No translation available.
AL691477 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11751.1
BC019221 mRNA Translation: AAH19221.1
BC032419 mRNA Translation: AAH32419.1 Different initiation.
BC110846 mRNA Translation: AAI10847.1
CCDSiCCDS14643.1 [Q7Z309-2]
CCDS55497.1 [Q7Z309-1]
CCDS55498.1 [Q7Z309-4]
CCDS55499.1 [Q7Z309-3]
RefSeqiNP_001160071.1, NM_001166599.3 [Q7Z309-1]
NP_001160072.1, NM_001166600.2 [Q7Z309-4]
NP_001164227.1, NM_001170756.1 [Q7Z309-3]
NP_001164228.1, NM_001170757.1
NP_660327.2, NM_145284.5 [Q7Z309-2]
XP_011529595.1, XM_011531293.1
UniGeneiHs.404706

3D structure databases

ProteinModelPortaliQ7Z309
SMRiQ7Z309
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127730, 21 interactors
IntActiQ7Z309, 7 interactors

PTM databases

iPTMnetiQ7Z309
PhosphoSitePlusiQ7Z309

Polymorphism and mutation databases

BioMutaiFAM122B

Proteomic databases

EPDiQ7Z309
MaxQBiQ7Z309
PeptideAtlasiQ7Z309
PRIDEiQ7Z309
ProteomicsDBi68995
68996 [Q7Z309-2]
68997 [Q7Z309-3]
68998 [Q7Z309-4]
68999 [Q7Z309-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
159090
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000298090; ENSP00000298090; ENSG00000156504 [Q7Z309-4]
ENST00000370790; ENSP00000359826; ENSG00000156504 [Q7Z309-1]
ENST00000486347; ENSP00000419592; ENSG00000156504 [Q7Z309-2]
ENST00000493333; ENSP00000487221; ENSG00000156504 [Q7Z309-3]
GeneIDi159090
KEGGihsa:159090
UCSCiuc004exr.4 human [Q7Z309-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
159090
EuPathDBiHostDB:ENSG00000156504.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FAM122B
HGNCiHGNC:30490 FAM122B
HPAiHPA000266
neXtProtiNX_Q7Z309
OpenTargetsiENSG00000156504
PharmGKBiPA128394763

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00390000015476
HOVERGENiHBG073694
InParanoidiQ7Z309
PhylomeDBiQ7Z309
TreeFamiTF330808

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FAM122B human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
FAM122B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
159090

Protein Ontology

More...
PROi
PR:Q7Z309

Gene expression databases

BgeeiENSG00000156504 Expressed in 204 organ(s), highest expression level in epithelial cell of pancreas
CleanExiHS_FAM122B
ExpressionAtlasiQ7Z309 baseline and differential
GenevisibleiQ7Z309 HS

Family and domain databases

InterProiView protein in InterPro
IPR026716 FAM122
PANTHERiPTHR22227 PTHR22227, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiF122B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7Z309
Secondary accession number(s): A8K902
, Q6PIM2, Q6ZU47, Q6ZV64, Q6ZVE4, Q8TB75
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: October 10, 2018
This is version 113 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again