Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q7Z2X4 (PCLI1_HUMAN)

Entry version 131 (02 Jun 2021)
Sequence version 1 (01 Oct 2003)
Previous versions | rss
Add a publicationFeedback
Protein

PTB-containing, cubilin and LRP1-interacting protein

Gene

PID1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Increases proliferation of preadipocytes without affecting adipocytic differentiation.

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q7Z2X4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PTB-containing, cubilin and LRP1-interacting protein
Short name:
P-CLI1
Alternative name(s):
Phosphotyrosine interaction domain-containing protein 1
Protein NYGGF4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PID1
Synonyms:NYGGF4, PCLI1
ORF Names:HMFN2073
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:26084, PID1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		612930, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q7Z2X4

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000153823.18

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		55022

Open Targets

More...OpenTargetsi		ENSG00000153823

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162399462

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q7Z2X4, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PID1

Domain mapping of disease mutations (DMDM)

More...DMDMi		74713284

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002749001 – 250PTB-containing, cubilin and LRP1-interacting proteinAdd BLAST250

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei236PhosphoserineBy similarity1
Modified residuei247PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q7Z2X4

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q7Z2X4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q7Z2X4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q7Z2X4

PeptideAtlas

More...PeptideAtlasi		Q7Z2X4

PRoteomics IDEntifications database

More...PRIDEi		Q7Z2X4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		68980 [Q7Z2X4-1]
68981 [Q7Z2X4-2]
68982 [Q7Z2X4-3]
68983 [Q7Z2X4-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q7Z2X4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q7Z2X4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in subcutaneous fat, heart, skeletal muscle, brain, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocyte.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in fat of obese subjects.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000153823, Expressed in forebrain and 231 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q7Z2X4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q7Z2X4, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000153823, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Found in a complex with PID1/PCLI1, LRP1 and CUBNI.

Interacts with LRP1 and CUBN.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		120352, 26 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q7Z2X4

Protein interaction database and analysis system

More...IntActi		Q7Z2X4, 12 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000375907

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q7Z2X4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q7Z2X4

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini93 – 250PIDPROSITE-ProRule annotationAdd BLAST158

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni229 – 250DisorderedSequence analysisAdd BLAST22

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4448, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00510000048154

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_088811_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q7Z2X4

Identification of Orthologs from Complete Genome Data

More...OMAi		HAKSRTH

Database of Orthologous Groups

More...OrthoDBi		1145472at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q7Z2X4

Family and domain databases

Conserved Domains Database

More...CDDi		cd13167, PTB_P-CLI1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011993, PH-like_dom_sf
IPR039112, PID1
IPR039114, PID1_PTB
IPR006020, PTB/PI_dom

The PANTHER Classification System

More...PANTHERi		PTHR16265, PTHR16265, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF14719, PID_2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00462, PTB, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01179, PID, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z2X4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFSLPLSLPL CEDTAFLPSK CCSSHKTIKQ ARTLIMIFLA SGTHFQTMLK 
        60         70         80         90        100
SKLNVLTLKK EPLPAVIFHE PEAIELCTTT PLMKTRTHSG CKVTYLGKVS 
       110        120        130        140        150
TTGMQFLSGC TEKPVIELWK KHTLAREDVF PANALLEIRP FQVWLHHLDH 
       160        170        180        190        200
KGEATVHMDT FQVARIAYCT ADHNVSPNIF AWVYREINDD LSYQMDCHAV 
       210        220        230        240        250
ECESKLEAKK LAHAMMEAFR KTFHSMKSDG RIHSNSSSEE VSQELESDDG
Length:250
Mass (Da):28,272
Last modified:October 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3C2F4AE5254D2885
GO
Isoform 2 (identifier: Q7Z2X4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MFSLPLSLPL...LIMIFLASGT → MPRIAGNHLM...LHFGLPASEM

Show »
Length:248
Mass (Da):28,121
Checksum:iD4D89783A12B71D3
GO
Isoform 3 (identifier: Q7Z2X4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     83-92: MKTRTHSGCK → MWQPATERLQ

Show »
Length:168
Mass (Da):19,285
Checksum:i5A8DBD3D2B54E512
GO
Isoform 4 (identifier: Q7Z2X4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGT → MWQPATERLQ

Show »
Length:217
Mass (Da):24,829
Checksum:i247256CD547081F5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H314F5H314_HUMAN
PTB-containing, cubilin and LRP1-in...
PID1
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD38656 differs from that shown. Reason: Erroneous initiation.Curated

<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement%5Fin%5Fdisease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Some sequences seem to have a duplication of exon 2.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03036143T → THFQTMLKSKLNVLTLKKEP LPAVIFHEPEAIELCTTTPL MKTRTHSGCK in variant with duplicated exon 2. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0229091 – 82Missing in isoform 3. 1 PublicationAdd BLAST82
Alternative sequenceiVSP_0229101 – 43MFSLP…LASGT → MPRIAGNHLMLEESRTCSSP ELLDGVWPCQPLHFGLPASE M in isoform 2. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_0229111 – 43MFSLP…LASGT → MWQPATERLQ in isoform 4. 2 PublicationsAdd BLAST43
Alternative sequenceiVSP_02291283 – 92MKTRTHSGCK → MWQPATERLQ in isoform 3. 1 Publication10

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB075874 mRNA Translation: BAD38656.1 Different initiation.
AY317148 mRNA Translation: AAP79437.1
AK000708 mRNA Translation: BAA91333.1
AK096636 mRNA Translation: BAG53344.1
AK125359 mRNA Translation: BAC86145.1
CH471063 Genomic DNA Translation: EAW70891.1
BC040164 mRNA Translation: AAH40164.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2471.1 [Q7Z2X4-2]
CCDS42830.1 [Q7Z2X4-4]
CCDS82577.1 [Q7Z2X4-1]
CCDS82578.1 [Q7Z2X4-3]

NCBI Reference Sequences

More...RefSeqi		NP_001094288.1, NM_001100818.1 [Q7Z2X4-4]
NP_001317085.1, NM_001330156.1 [Q7Z2X4-1]
NP_001317086.1, NM_001330157.1 [Q7Z2X4-3]
NP_060403.3, NM_017933.4 [Q7Z2X4-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000354069; ENSP00000283937; ENSG00000153823 [Q7Z2X4-1]
ENST00000392054; ENSP00000375907; ENSG00000153823 [Q7Z2X4-2]
ENST00000392055; ENSP00000375908; ENSG00000153823 [Q7Z2X4-4]
ENST00000409462; ENSP00000386826; ENSG00000153823 [Q7Z2X4-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		55022

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:55022

UCSC genome browser

More...UCSCi		uc002vpr.5, human [Q7Z2X4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB075874 mRNA Translation: BAD38656.1 Different initiation.
AY317148 mRNA Translation: AAP79437.1
AK000708 mRNA Translation: BAA91333.1
AK096636 mRNA Translation: BAG53344.1
AK125359 mRNA Translation: BAC86145.1
CH471063 Genomic DNA Translation: EAW70891.1
BC040164 mRNA Translation: AAH40164.1
CCDSiCCDS2471.1 [Q7Z2X4-2]
CCDS42830.1 [Q7Z2X4-4]
CCDS82577.1 [Q7Z2X4-1]
CCDS82578.1 [Q7Z2X4-3]
RefSeqiNP_001094288.1, NM_001100818.1 [Q7Z2X4-4]
NP_001317085.1, NM_001330156.1 [Q7Z2X4-1]
NP_001317086.1, NM_001330157.1 [Q7Z2X4-3]
NP_060403.3, NM_017933.4 [Q7Z2X4-2]

3D structure databases

SMRiQ7Z2X4
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi120352, 26 interactors
CORUMiQ7Z2X4
IntActiQ7Z2X4, 12 interactors
STRINGi9606.ENSP00000375907

PTM databases

iPTMnetiQ7Z2X4
PhosphoSitePlusiQ7Z2X4

Genetic variation databases

BioMutaiPID1
DMDMi74713284

Proteomic databases

EPDiQ7Z2X4
jPOSTiQ7Z2X4
MassIVEiQ7Z2X4
PaxDbiQ7Z2X4
PeptideAtlasiQ7Z2X4
PRIDEiQ7Z2X4
ProteomicsDBi68980 [Q7Z2X4-1]
68981 [Q7Z2X4-2]
68982 [Q7Z2X4-3]
68983 [Q7Z2X4-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		34394, 116 antibodies

The DNASU plasmid repository

More...DNASUi		55022

Genome annotation databases

EnsembliENST00000354069; ENSP00000283937; ENSG00000153823 [Q7Z2X4-1]
ENST00000392054; ENSP00000375907; ENSG00000153823 [Q7Z2X4-2]
ENST00000392055; ENSP00000375908; ENSG00000153823 [Q7Z2X4-4]
ENST00000409462; ENSP00000386826; ENSG00000153823 [Q7Z2X4-3]
GeneIDi55022
KEGGihsa:55022
UCSCiuc002vpr.5, human [Q7Z2X4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		55022
DisGeNETi55022

GeneCards: human genes, protein and diseases

More...GeneCardsi		PID1
HGNCiHGNC:26084, PID1
HPAiENSG00000153823, Low tissue specificity
MIMi612930, gene
neXtProtiNX_Q7Z2X4
OpenTargetsiENSG00000153823
PharmGKBiPA162399462
VEuPathDBiHostDB:ENSG00000153823.18

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4448, Eukaryota
GeneTreeiENSGT00510000048154
HOGENOMiCLU_088811_0_0_1
InParanoidiQ7Z2X4
OMAiHAKSRTH
OrthoDBi1145472at2759
PhylomeDBiQ7Z2X4

Enzyme and pathway databases

PathwayCommonsiQ7Z2X4

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		55022, 4 hits in 991 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PID1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		55022
PharosiQ7Z2X4, Tbio

Protein Ontology

More...PROi		PR:Q7Z2X4
RNActiQ7Z2X4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000153823, Expressed in forebrain and 231 other tissues
ExpressionAtlasiQ7Z2X4, baseline and differential
GenevisibleiQ7Z2X4, HS

Family and domain databases

CDDicd13167, PTB_P-CLI1, 1 hit
Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993, PH-like_dom_sf
IPR039112, PID1
IPR039114, PID1_PTB
IPR006020, PTB/PI_dom
PANTHERiPTHR16265, PTHR16265, 1 hit
PfamiView protein in Pfam
PF14719, PID_2, 1 hit
SMARTiView protein in SMART
SM00462, PTB, 1 hit
PROSITEiView protein in PROSITE
PS01179, PID, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPCLI1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7Z2X4
Secondary accession number(s): B3KU82
, Q68CJ2, Q6ZUS3, Q8IXL0, Q9NWP6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: October 1, 2003
Last modified: June 2, 2021
This is version 131 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again