Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (29 Sep 2021)
Sequence version 1 (01 Oct 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Activating transcription factor 7-interacting protein 1

Gene

Atf7ip

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Recruiter that couples transcriptional factors to general transcription apparatus and thereby modulates transcription regulation and chromatin formation. Can both act as an activator or a repressor depending on the context (PubMed:10777215).

Required for HUSH-mediated heterochromatin formation and gene silencing (By similarity).

Mediates MBD1-dependent transcriptional repression, probably by recruiting complexes containing SETDB1. Stabilizes SETDB1, is required to stimulate histone methyltransferase activity of SETDB1 and facilitates the conversion of dimethylated to trimethylated H3 'Lys-9' (H3K9me3). The complex formed with MBD1 and SETDB1 represses transcription and couples DNA methylation and histone H3 'Lys-9' trimethylation (H3K9me3) (PubMed:14536086).

Facilitates telomerase TERT and TERC gene expression by SP1 in cancer cells (By similarity).

By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • transcription corepressor activity Source: MGI

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Repressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-3214841, PKMTs methylate histone lysines

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Activating transcription factor 7-interacting protein 1
Alternative name(s):
ATFa-associated modulator
Short name:
mAM
MBD1-containing chromatin-associated factor 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Atf7ip
Synonyms:Mcaf1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1858965, Atf7ip

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000030213

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002817811 – 1306Activating transcription factor 7-interacting protein 1Add BLAST1306

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki33Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei57PhosphoserineCombined sources1
Modified residuei112PhosphoserineCombined sources1
Modified residuei124PhosphothreonineBy similarity1
Modified residuei511PhosphoserineBy similarity1
Modified residuei514PhosphoserineCombined sources1
Modified residuei516PhosphoserineCombined sources1
Modified residuei533PhosphoserineBy similarity1
Cross-linki592Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei593PhosphoserineCombined sources1
Modified residuei700PhosphoserineCombined sources1
Modified residuei707PhosphoserineBy similarity1
Modified residuei933PhosphoserineBy similarity1
Cross-linki944Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki974Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7TT18

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q7TT18

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7TT18

PeptideAtlas

More...
PeptideAtlasi
Q7TT18

PRoteomics IDEntifications database

More...
PRIDEi
Q7TT18

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
295837 [Q7TT18-1]
295838 [Q7TT18-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7TT18

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7TT18

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed at all stages studied.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000030213, Expressed in zygote and 306 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7TT18, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7TT18, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MBD1; the interaction is enhanced when MBD1 is sumoylated (By similarity).

Interacts with SETDB1; the interaction protects SETDB1 from proteasomal degradation and is required to stimulate histone methyltransferase activity and facilitate the conversion of dimethylated to trimethylated H3 'Lys-9' (PubMed:14536086).

Interacts with SUMO ubiquitin-like proteins (SUMO1, SUNO2 and SUMO3), with a preference for SUMO2 and SUMO3.

Interacts with SP1, ATF7 and ZHX1.

Interacts with the general transcription machinery, including ERCC2, ERCC3, GTF2E1, GTF2E2 and POLR2A (By similarity).

By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
207616, 13 interactors

Protein interaction database and analysis system

More...
IntActi
Q7TT18, 4 interactors

Molecular INTeraction database

More...
MINTi
Q7TT18

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000032335

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q7TT18, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7TT18

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1054 – 1143Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST90
Domaini1196 – 1302Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST107

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 23DisorderedSequence analysisAdd BLAST23
Regioni104 – 470DisorderedSequence analysisAdd BLAST367
Regioni496 – 604DisorderedSequence analysisAdd BLAST109
Regioni596 – 851Interaction with SETDB1By similarityAdd BLAST256
Regioni689 – 722DisorderedSequence analysisAdd BLAST34
Regioni765 – 785DisorderedSequence analysisAdd BLAST21
Regioni871 – 895DisorderedSequence analysisAdd BLAST25
Regioni920 – 1060DisorderedSequence analysisAdd BLAST141
Regioni1001 – 1011Interaction with SUMOBy similarityAdd BLAST11
Regioni1152 – 1196DisorderedSequence analysisAdd BLAST45
Regioni1190 – 1306Interaction with MBD1By similarityAdd BLAST117

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili666 – 696Sequence analysisAdd BLAST31

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi587 – 605Nuclear localization signal1 PublicationAdd BLAST19

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi104 – 161Polar residuesSequence analysisAdd BLAST58
Compositional biasi175 – 212Polar residuesSequence analysisAdd BLAST38
Compositional biasi288 – 303Polar residuesSequence analysisAdd BLAST16
Compositional biasi354 – 372Basic and acidic residuesSequence analysisAdd BLAST19
Compositional biasi428 – 444Basic and acidic residuesSequence analysisAdd BLAST17
Compositional biasi452 – 466Acidic residuesSequence analysisAdd BLAST15
Compositional biasi556 – 604Basic and acidic residuesSequence analysisAdd BLAST49
Compositional biasi765 – 781Polar residuesSequence analysisAdd BLAST17
Compositional biasi920 – 1003Polar residuesSequence analysisAdd BLAST84
Compositional biasi1017 – 1038Polar residuesSequence analysisAdd BLAST22
Compositional biasi1039 – 1053Pro residuesSequence analysisAdd BLAST15
Compositional biasi1168 – 1186Pro residuesSequence analysisAdd BLAST19

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MCAF family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QSM2, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063707

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_009529_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7TT18

Identification of Orthologs from Complete Genome Data

More...
OMAi
VRASPMQ

Database of Orthologous Groups

More...
OrthoDBi
324622at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7TT18

TreeFam database of animal gene trees

More...
TreeFami
TF329427

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026085, ATF7-int
IPR031870, ATF7IP_BD
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR013783, Ig-like_fold

The PANTHER Classification System

More...
PANTHERi
PTHR23210, PTHR23210, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16788, ATF7IP_BD, 1 hit
PF16794, fn3_4, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49265, SSF49265, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853, FN3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7TT18-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDSVEEPQKK VFKARKTMRA SDRQQLDAVH RVKGELLRAD GKLLNGSHEN
60 70 80 90 100
GDLDPTSPLE NTDCIQDREE VNGIDGICFQ SEESTTEWKE TPCMPNVAVK
110 120 130 140 150
NKQEDLNSEA LSPSITCDLS SRVTTEPGSG SPASDNPGCG TPVSDNPASD
160 170 180 190 200
NPASDNPASD NPDSGDLAAG ELATTVQATG DSACEEPPSS DPSSSDPTSS
210 220 230 240 250
EPSSSEPTCS EPISGDPVSE EAASHDLVSG DSTCSEPVSG EPVSHEAASS
260 270 280 290 300
EPATSEPASD EPVARVVAAC ELAPGESALD DCAPSGDSQS DEPPSSEDSL
310 320 330 340 350
PRSVCSGLAS GELTPGELSV EPATDTVKPS SSAVCEAGPD PDKTEPSSNN
360 370 380 390 400
SDDCPGKSED DEHLDQIQSK DSCDEGNKVN SNVVEKEEPL ETHSAIICSD
410 420 430 440 450
LPPENTTKIA EDPIAEPALE EEAISSSMEV DQSEKDEHKS PAEPVAAVSE
460 470 480 490 500
DPAEEDKEDT VVDNTDSMET DEIIPILEKL APTEDELSCF SKASLLPVET
510 520 530 540 550
SQDLEDKMEG SFGSPSKQES SENLPKEAFL VLSDEEDLSC GKDESEAVAQ
560 570 580 590 600
SKMSTPEGEK SEKDGKAEEE ERVPAEEQPP VRNEFSRRKR SKSEDMDSVE
610 620 630 640 650
SKRRRYMDEE YEAEFQVKIT AKGDINQKLQ KVIQWLLQEK LCALQCAVFD
660 670 680 690 700
KTLAELKTRV EKIECNKRHK AVLTELQAKI ARLTKRFGAA KDDLKKRQES
710 720 730 740 750
PPNPPISPGK PANDTNSNNN MTYRNAGTVR QLLESKRNVS EGPPPSFQTP
760 770 780 790 800
VNTVSSASHA TSTAVVSSQP KLQTSATSGS LPAAPLLPAP STATVVATTQ
810 820 830 840 850
VPSGTPQPTI SLQPLPVILH VPVAVTSQPQ LLQSHPGTLV TNQPSGNVEF
860 870 880 890 900
ISVQSQPTVS GLTKNPVSLP PLPNPTKPNI PSVPSPSSIQ RNSSTTAAPL
910 920 930 940 950
GTTLAVQAVP TAHSIVQATR TSLPTVGPSG LYSSSSSRGP IQMKIPISTF
960 970 980 990 1000
SPPSSAEQNS SATPRIVTEN QTNKTVDSSI NKKAADSTSQ SGKASSSDSS
1010 1020 1030 1040 1050
GVIDLTMDDE ESGTTQDPKK ISPPSSSTVS TSQPMSRPLQ PILPAPPLQP
1060 1070 1080 1090 1100
SGVPTSGPSQ ATIHVLPTAP TTVNVTHRPV TQVTTRLPVP RAPANHQVVY
1110 1120 1130 1140 1150
TTLPAPTTQA PLRGTVMQAP AVRQVNPQNS VTVRVPQTTT YVVNNGLTLG
1160 1170 1180 1190 1200
SAGPQLTVHH RPPQVHNEPP RPLHPAPLPE APQPQRLPPE AASTSLPQKP
1210 1220 1230 1240 1250
HLKLARVQSQ NGIVLSWSVL EVDRSCATVD SYHLYAYHEE PSATVPSQWK
1260 1270 1280 1290 1300
KIGEVKALPL PMACTLTQFV SGSKYYFAVR AKDIYGRFGP FCDPQSTDVI

SSSQNS
Length:1,306
Mass (Da):138,593
Last modified:October 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD09FE3ACC93FA207
GO
Isoform 2 (identifier: Q7TT18-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-959: Missing.
     960-989: SSATPRIVTENQTNKTVDSSINKKAADSTS → MRPFSPLPLLLPHISLVASAPLQNQTSFIF

Show »
Length:347
Mass (Da):37,258
Checksum:i8F620344A6744ABE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0N4SVP5A0A0N4SVP5_MOUSE
Activating transcription factor 7-i...
Atf7ip
345Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WQB3A0A087WQB3_MOUSE
Activating transcription factor 7-i...
Atf7ip
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WR75A0A087WR75_MOUSE
Activating transcription factor 7-i...
Atf7ip
969Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WR39A0A087WR39_MOUSE
Activating transcription factor 7-i...
Atf7ip
559Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0N4SVA8A0A0N4SVA8_MOUSE
Activating transcription factor 7-i...
Atf7ip
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WNQ2A0A087WNQ2_MOUSE
Activating transcription factor 7-i...
Atf7ip
107Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WPT6A0A087WPT6_MOUSE
Activating transcription factor 7-i...
Atf7ip
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAE39609 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti121S → Y in BAE22064 (PubMed:16141072).Curated1
Sequence conflicti128G → A in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti128G → A in AAH22714 (PubMed:15489334).Curated1
Sequence conflicti128G → A in AAH48827 (PubMed:15489334).Curated1
Sequence conflicti235S → G in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti235S → G in AAH22714 (PubMed:15489334).Curated1
Sequence conflicti235S → G in AAH48827 (PubMed:15489334).Curated1
Sequence conflicti287D → E in AAH22714 (PubMed:15489334).Curated1
Sequence conflicti287D → E in AAH48827 (PubMed:15489334).Curated1
Sequence conflicti539S → L in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti539S → L in AAH22714 (PubMed:15489334).Curated1
Sequence conflicti539S → L in AAH48827 (PubMed:15489334).Curated1
Sequence conflicti545S → P in BAE39609 (PubMed:16141072).Curated1
Sequence conflicti547A → V in AAH22714 (PubMed:15489334).Curated1
Sequence conflicti547A → V in AAH48827 (PubMed:15489334).Curated1
Sequence conflicti551S → T in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti551S → T in AAH22714 (PubMed:15489334).Curated1
Sequence conflicti551S → T in AAH48827 (PubMed:15489334).Curated1
Sequence conflicti564 – 565DG → GS in CAB77024 (PubMed:10777215).Curated2
Sequence conflicti600 – 602ESK → QST in CAB77024 (PubMed:10777215).Curated3
Sequence conflicti622K → G in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti631K → E in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti634Q → R in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti964P → T in BAE39609 (PubMed:16141072).Curated1
Sequence conflicti968T → A in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti1201H → Q in BAE39609 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0240401 – 959Missing in isoform 2. 1 PublicationAdd BLAST959
Alternative sequenceiVSP_024041960 – 989SSATP…ADSTS → MRPFSPLPLLLPHISLVASA PLQNQTSFIF in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ132702 mRNA Translation: CAB77024.1
BC022714 mRNA Translation: AAH22714.1 Different termination.
AK082697 mRNA Translation: BAC38574.1
AK134252 mRNA Translation: BAE22064.1
AK137199 mRNA Translation: BAE23264.1
AK157479 mRNA Translation: BAE34096.1
AK167542 mRNA Translation: BAE39609.1 Frameshift.
BC048827 mRNA Translation: AAH48827.1 Different termination.
BC052460 mRNA Translation: AAH52460.1
BC060246 mRNA Translation: AAH60246.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS20651.1 [Q7TT18-1]

NCBI Reference Sequences

More...
RefSeqi
NP_062299.2, NM_019426.2 [Q7TT18-1]
XP_006506452.2, XM_006506389.3 [Q7TT18-1]
XP_017177170.1, XM_017321681.1 [Q7TT18-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000032335; ENSMUSP00000032335; ENSMUSG00000030213 [Q7TT18-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54343

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:54343

UCSC genome browser

More...
UCSCi
uc009elv.1, mouse [Q7TT18-1]
uc009elx.1, mouse [Q7TT18-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ132702 mRNA Translation: CAB77024.1
BC022714 mRNA Translation: AAH22714.1 Different termination.
AK082697 mRNA Translation: BAC38574.1
AK134252 mRNA Translation: BAE22064.1
AK137199 mRNA Translation: BAE23264.1
AK157479 mRNA Translation: BAE34096.1
AK167542 mRNA Translation: BAE39609.1 Frameshift.
BC048827 mRNA Translation: AAH48827.1 Different termination.
BC052460 mRNA Translation: AAH52460.1
BC060246 mRNA Translation: AAH60246.1
CCDSiCCDS20651.1 [Q7TT18-1]
RefSeqiNP_062299.2, NM_019426.2 [Q7TT18-1]
XP_006506452.2, XM_006506389.3 [Q7TT18-1]
XP_017177170.1, XM_017321681.1 [Q7TT18-1]

3D structure databases

SMRiQ7TT18
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi207616, 13 interactors
IntActiQ7TT18, 4 interactors
MINTiQ7TT18
STRINGi10090.ENSMUSP00000032335

PTM databases

iPTMnetiQ7TT18
PhosphoSitePlusiQ7TT18

Proteomic databases

EPDiQ7TT18
jPOSTiQ7TT18
PaxDbiQ7TT18
PeptideAtlasiQ7TT18
PRIDEiQ7TT18
ProteomicsDBi295837 [Q7TT18-1]
295838 [Q7TT18-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
12020, 91 antibodies

The DNASU plasmid repository

More...
DNASUi
54343

Genome annotation databases

EnsembliENSMUST00000032335; ENSMUSP00000032335; ENSMUSG00000030213 [Q7TT18-1]
GeneIDi54343
KEGGimmu:54343
UCSCiuc009elv.1, mouse [Q7TT18-1]
uc009elx.1, mouse [Q7TT18-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55729
MGIiMGI:1858965, Atf7ip
VEuPathDBiHostDB:ENSMUSG00000030213

Phylogenomic databases

eggNOGiENOG502QSM2, Eukaryota
GeneTreeiENSGT00530000063707
HOGENOMiCLU_009529_0_0_1
InParanoidiQ7TT18
OMAiVRASPMQ
OrthoDBi324622at2759
PhylomeDBiQ7TT18
TreeFamiTF329427

Enzyme and pathway databases

ReactomeiR-MMU-3214841, PKMTs methylate histone lysines

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
54343, 11 hits in 66 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Atf7ip, mouse

Protein Ontology

More...
PROi
PR:Q7TT18
RNActiQ7TT18, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000030213, Expressed in zygote and 306 other tissues
ExpressionAtlasiQ7TT18, baseline and differential
GenevisibleiQ7TT18, MM

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR026085, ATF7-int
IPR031870, ATF7IP_BD
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR013783, Ig-like_fold
PANTHERiPTHR23210, PTHR23210, 1 hit
PfamiView protein in Pfam
PF16788, ATF7IP_BD, 1 hit
PF16794, fn3_4, 1 hit
SUPFAMiSSF49265, SSF49265, 1 hit
PROSITEiView protein in PROSITE
PS50853, FN3, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMCAF1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7TT18
Secondary accession number(s): Q3TJ86
, Q3TZW1, Q3UVK5, Q3UYZ7, Q80ZK7, Q8C4A1, Q9JK31
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: October 1, 2003
Last modified: September 29, 2021
This is version 145 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again