Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (18 Sep 2019)
Sequence version 1 (01 Oct 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ataxin-2-like protein

Gene

Atxn2l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the regulation of stress granule and P-body formation.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ataxin-2-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Atxn2l
Synonyms:A2lp
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2446242 Atxn2l

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000647551 – 1049Ataxin-2-like proteinAdd BLAST1049

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
Modified residuei27PhosphoserineCombined sources1
Modified residuei45PhosphothreonineCombined sources1
Modified residuei109PhosphoserineCombined sources1
Modified residuei116PhosphotyrosineBy similarity1
Modified residuei205N6-acetyllysineCombined sources1
Modified residuei236PhosphoserineCombined sources1
Modified residuei262PhosphotyrosineBy similarity1
Modified residuei304PhosphoserineBy similarity1
Modified residuei307PhosphotyrosineBy similarity1
Modified residuei333PhosphoserineBy similarity1
Modified residuei337PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki346Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei347PhosphotyrosineBy similarity1
Modified residuei359Asymmetric dimethylarginineBy similarity1
Modified residuei389PhosphoserineBy similarity1
Modified residuei407PhosphoserineCombined sources1
Modified residuei453PhosphoserineBy similarity1
Modified residuei496PhosphoserineCombined sources1
Modified residuei499PhosphoserineCombined sources1
Modified residuei560PhosphoserineCombined sources1
Modified residuei561PhosphoserineBy similarity1
Modified residuei562PhosphoserineBy similarity1
Modified residuei597PhosphoserineCombined sources1
Modified residuei635PhosphothreonineBy similarity1
Modified residuei637PhosphoserineCombined sources1
Modified residuei677PhosphoserineBy similarity1
Modified residuei683PhosphoserineBy similarity1
Modified residuei687PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Thrombopoietin triggers the phosphorylation on tyrosine residues in a way that is dependent on MPL C-terminal domain.By similarity
Asymmetrically dimethylated. Probably methylated by PRMT1.By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7TQH0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q7TQH0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7TQH0

PeptideAtlas

More...
PeptideAtlasi
Q7TQH0

PRoteomics IDEntifications database

More...
PRIDEi
Q7TQH0

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7TQH0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7TQH0

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q7TQH0

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q7TQH0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in cerebellum.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000032637 Expressed in 234 organ(s), highest expression level in rostral migratory stream

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7TQH0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7TQH0 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MPL/TPOR and EPOR and dissociates after ligand stimulation.

Interacts with DDX6, G3BP, and ATXN2.

Interacts with PRMT1 (By similarity).

Interacts with CIC and ATXN1 (PubMed:17322884).

By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
231460, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q7TQH0, 3 interactors

Molecular INTeraction database

More...
MINTi
Q7TQH0

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000035415

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni96 – 119Interaction with MPLBy similarityAdd BLAST24

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi4 – 61Pro-richAdd BLAST58

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ataxin-2 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2375 Eukaryota
COG5180 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157795

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000234354

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7TQH0

Database of Orthologous Groups

More...
OrthoDBi
282700at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7TQH0

TreeFam database of animal gene trees

More...
TreeFami
TF326591

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009818 Ataxin-2_C
IPR009604 LsmAD_domain
IPR025852 SM_dom_ATX

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06741 LsmAD, 1 hit
PF07145 PAM2, 1 hit
PF14438 SM-ATX, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01272 LsmAD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7TQH0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLKPQPPQQT SQPQQPPPTQ QAVARRSPGG TSPPNGGLPG PLTATAAPPG
60 70 80 90 100
PPAAVSPCLG PAAAAGSGLR RGAESILAAS APPQHQERPG AVAIGSVRGQ
110 120 130 140 150
TTGKGPPQSP VFEGVYNNSR MLHFLTAVVG STCDVKVKNG TTYEGIFKTL
160 170 180 190 200
SSKFELAVDA VHRKASEPAG GPRREDIVDT MVFKPSDVLL VHFRNVDFNY
210 220 230 240 250
ATKDKFTDSA IAMNSKVNGE HKEKVLQRWE GGDSNSDDYD LESDMSNGWD
260 270 280 290 300
PNEMFKFNEE NYGVKTTYDS SLSSYTVPLE KDNSEEFRQR ELRAAQLARE
310 320 330 340 350
IESSPQYRLR IAMENDDGRT EEEKHSAVQR QGSGRESPSL VSREGKYIPL
360 370 380 390 400
PQRVREGPRG GVRCSSSRGG RPGLSSLPPR GPHHLDNSSP GPGSEARGIN
410 420 430 440 450
GGPSRMSPKA QRPLRGAKTL SSPSNRPSGE ASVPPTSAAL PFLPVGRMYP
460 470 480 490 500
PRSPKSAAPA PVSASCPEPP IGSAVASSAS IPVTSSVVDP GAGSISPASP
510 520 530 540 550
KLSLTPTDVK ELPTKEPSRN LEAQELARIA GKVPGLQNEQ KRFQLEELRK
560 570 580 590 600
FGAQFKLQPS SSPETGLDPF PSRILKEEAK GKEKEVDGLL TSDPMGSPVS
610 620 630 640 650
SKTESILDKE DKVPMAGVGG TEGPEQLPAP CPSQTGSPPV GLIKGDEKEE
660 670 680 690 700
GPVTEQVKKS TLNPNAKEFN PTKPLLSVNK STSTPTSPGP RTHSTPSIPV
710 720 730 740 750
LTAGQSGLYS PQYISYIPQI HMGPAVQAPQ MYPYPVSNSV PGQQGKYRGA
760 770 780 790 800
KGSLPPQRSD QHQPASAPPM MQAAAAAAGP PLVAATPYSS YIPYNPQQFP
810 820 830 840 850
GQPAMMQPMA HYPSQPVFAP MLQSNPRMLT SGSHPQAIVS SSTPQYPAAE
860 870 880 890 900
QPTPQALYAT VHQSYPHHAT QLHGHQPQPA TTPTGSQPQS QHAAPSPVQH
910 920 930 940 950
QAGQAPHLGS GQPQQNLYHP GALTGTPPSL PPGPSAQSPQ SSFPQPAAVY
960 970 980 990 1000
AIHPHQQLPH GFTNMAHVTQ AHVQTGVTAA PPPHPGAPHP PQVMLLHPPQ
1010 1020 1030 1040
GHGGPPQGAV PPSGVPALSA STPSPYPYIG HPQVQSHPSQ QLPFHPPGN
Length:1,049
Mass (Da):110,649
Last modified:October 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i27ECCFE500688D45
GO
Isoform 2 (identifier: Q7TQH0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     439-444: Missing.
     1034-1049: VQSHPSQQLPFHPPGN → GEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGD

Note: No experimental confirmation available.
Show »
Length:1,074
Mass (Da):113,043
Checksum:iB1D4892E2506AC59
GO
Isoform 3 (identifier: Q7TQH0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     439-444: Missing.

Note: No experimental confirmation available.
Show »
Length:1,043
Mass (Da):110,010
Checksum:i0CC40AF28EEB87BE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RPL0A0A0U1RPL0_MOUSE
Ataxin-2-like protein
Atxn2l
1,096Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q3TGG2Q3TGG2_MOUSE
Ataxin-2-like protein
Atxn2l
994Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q5Q0E9Q5Q0_MOUSE
Ataxin-2-like protein
Atxn2l
863Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RNZ9A0A0U1RNZ9_MOUSE
Ataxin-2-like protein
Atxn2l
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QP59J3QP59_MOUSE
Ataxin-2-like protein
Atxn2l
218Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_011595439 – 444Missing in isoform 2 and isoform 3. 1 Publication6
Alternative sequenceiVSP_0115961034 – 1049VQSHP…HPPGN → GEQPGQAPGFPGGADDRIRE FSLAGGIWHGRAEGLQVGQD ARVLGGD in isoform 2. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BC034083 mRNA Translation: AAH34083.1
BC043451 mRNA Translation: AAH43451.1
BC054483 mRNA Translation: AAH54483.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS21831.1 [Q7TQH0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_898841.1, NM_183020.1 [Q7TQH0-1]
XP_006507788.1, XM_006507725.2 [Q7TQH0-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000040202; ENSMUSP00000035415; ENSMUSG00000032637 [Q7TQH0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
233871

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:233871

UCSC genome browser

More...
UCSCi
uc009jrr.1 mouse [Q7TQH0-3]
uc009jrs.1 mouse [Q7TQH0-1]
uc009jru.1 mouse [Q7TQH0-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC034083 mRNA Translation: AAH34083.1
BC043451 mRNA Translation: AAH43451.1
BC054483 mRNA Translation: AAH54483.1
CCDSiCCDS21831.1 [Q7TQH0-1]
RefSeqiNP_898841.1, NM_183020.1 [Q7TQH0-1]
XP_006507788.1, XM_006507725.2 [Q7TQH0-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi231460, 3 interactors
IntActiQ7TQH0, 3 interactors
MINTiQ7TQH0
STRINGi10090.ENSMUSP00000035415

PTM databases

iPTMnetiQ7TQH0
PhosphoSitePlusiQ7TQH0
SwissPalmiQ7TQH0

Proteomic databases

EPDiQ7TQH0
jPOSTiQ7TQH0
PaxDbiQ7TQH0
PeptideAtlasiQ7TQH0
PRIDEiQ7TQH0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000040202; ENSMUSP00000035415; ENSMUSG00000032637 [Q7TQH0-1]
GeneIDi233871
KEGGimmu:233871
UCSCiuc009jrr.1 mouse [Q7TQH0-3]
uc009jrs.1 mouse [Q7TQH0-1]
uc009jru.1 mouse [Q7TQH0-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
11273
MGIiMGI:2446242 Atxn2l

Phylogenomic databases

eggNOGiKOG2375 Eukaryota
COG5180 LUCA
GeneTreeiENSGT00940000157795
HOGENOMiHOG000234354
InParanoidiQ7TQH0
OrthoDBi282700at2759
PhylomeDBiQ7TQH0
TreeFamiTF326591

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Atxn2l mouse
PMAP-CutDBiQ7TQH0

Protein Ontology

More...
PROi
PR:Q7TQH0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000032637 Expressed in 234 organ(s), highest expression level in rostral migratory stream
ExpressionAtlasiQ7TQH0 baseline and differential
GenevisibleiQ7TQH0 MM

Family and domain databases

InterProiView protein in InterPro
IPR009818 Ataxin-2_C
IPR009604 LsmAD_domain
IPR025852 SM_dom_ATX
PfamiView protein in Pfam
PF06741 LsmAD, 1 hit
PF07145 PAM2, 1 hit
PF14438 SM-ATX, 1 hit
SMARTiView protein in SMART
SM01272 LsmAD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATX2L_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7TQH0
Secondary accession number(s): Q80XN9, Q8K059
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: October 1, 2003
Last modified: September 18, 2019
This is version 121 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again