Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ataxin-2-like protein

Gene

Atxn2l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in the regulation of stress granule and P-body formation.By similarity

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Ataxin-2-like protein
Gene namesi
Name:Atxn2l
Synonyms:A2lp
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:2446242 Atxn2l

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000647551 – 1049Ataxin-2-like proteinAdd BLAST1049

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei27PhosphoserineCombined sources1
Modified residuei45PhosphothreonineCombined sources1
Modified residuei109PhosphoserineCombined sources1
Modified residuei116PhosphotyrosineBy similarity1
Modified residuei205N6-acetyllysineCombined sources1
Modified residuei236PhosphoserineCombined sources1
Modified residuei262PhosphotyrosineBy similarity1
Modified residuei304PhosphoserineBy similarity1
Modified residuei307PhosphotyrosineBy similarity1
Modified residuei333PhosphoserineBy similarity1
Modified residuei337PhosphoserineBy similarity1
Cross-linki346Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei347PhosphotyrosineBy similarity1
Modified residuei359Asymmetric dimethylarginineBy similarity1
Modified residuei389PhosphoserineBy similarity1
Modified residuei407PhosphoserineCombined sources1
Modified residuei453PhosphoserineBy similarity1
Modified residuei496PhosphoserineCombined sources1
Modified residuei499PhosphoserineCombined sources1
Modified residuei560PhosphoserineCombined sources1
Modified residuei561PhosphoserineBy similarity1
Modified residuei562PhosphoserineBy similarity1
Modified residuei597PhosphoserineCombined sources1
Modified residuei635PhosphothreonineBy similarity1
Modified residuei637PhosphoserineCombined sources1
Modified residuei677PhosphoserineBy similarity1
Modified residuei683PhosphoserineBy similarity1
Modified residuei687PhosphoserineBy similarity1

Post-translational modificationi

Thrombopoietin triggers the phosphorylation on tyrosine residues in a way that is dependent on MPL C-terminal domain.By similarity
Asymmetrically dimethylated. Probably methylated by PRMT1.By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ7TQH0
PeptideAtlasiQ7TQH0
PRIDEiQ7TQH0

PTM databases

iPTMnetiQ7TQH0
PhosphoSitePlusiQ7TQH0

Miscellaneous databases

PMAP-CutDBiQ7TQH0

Expressioni

Tissue specificityi

Expressed in cerebellum.1 Publication

Gene expression databases

BgeeiENSMUSG00000032637 Expressed in 234 organ(s), highest expression level in rostral migratory stream
CleanExiMM_ATXN2L
ExpressionAtlasiQ7TQH0 baseline and differential
GenevisibleiQ7TQH0 MM

Interactioni

Subunit structurei

Interacts with MPL/TPOR and EPOR and dissociates after ligand stimulation. Interacts with DDX6, G3BP, and ATXN2. Interacts with PRMT1 (By similarity). Interacts with CIC and ATXN1 (PubMed:17322884).By similarity1 Publication

Protein-protein interaction databases

BioGridi231460, 3 interactors
IntActiQ7TQH0, 3 interactors
MINTiQ7TQH0
STRINGi10090.ENSMUSP00000035415

Structurei

3D structure databases

ProteinModelPortaliQ7TQH0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni96 – 119Interaction with MPLBy similarityAdd BLAST24

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi4 – 61Pro-richAdd BLAST58

Sequence similaritiesi

Belongs to the ataxin-2 family.Curated

Phylogenomic databases

eggNOGiKOG2375 Eukaryota
COG5180 LUCA
GeneTreeiENSGT00530000063565
HOGENOMiHOG000234354
HOVERGENiHBG050623
InParanoidiQ7TQH0
OrthoDBiEOG091G01U5
PhylomeDBiQ7TQH0
TreeFamiTF326591

Family and domain databases

InterProiView protein in InterPro
IPR009818 Ataxin-2_C
IPR009604 LsmAD_domain
IPR025852 SM_dom_ATX
PfamiView protein in Pfam
PF06741 LsmAD, 1 hit
PF07145 PAM2, 1 hit
PF14438 SM-ATX, 1 hit
SMARTiView protein in SMART
SM01272 LsmAD, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7TQH0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLKPQPPQQT SQPQQPPPTQ QAVARRSPGG TSPPNGGLPG PLTATAAPPG
60 70 80 90 100
PPAAVSPCLG PAAAAGSGLR RGAESILAAS APPQHQERPG AVAIGSVRGQ
110 120 130 140 150
TTGKGPPQSP VFEGVYNNSR MLHFLTAVVG STCDVKVKNG TTYEGIFKTL
160 170 180 190 200
SSKFELAVDA VHRKASEPAG GPRREDIVDT MVFKPSDVLL VHFRNVDFNY
210 220 230 240 250
ATKDKFTDSA IAMNSKVNGE HKEKVLQRWE GGDSNSDDYD LESDMSNGWD
260 270 280 290 300
PNEMFKFNEE NYGVKTTYDS SLSSYTVPLE KDNSEEFRQR ELRAAQLARE
310 320 330 340 350
IESSPQYRLR IAMENDDGRT EEEKHSAVQR QGSGRESPSL VSREGKYIPL
360 370 380 390 400
PQRVREGPRG GVRCSSSRGG RPGLSSLPPR GPHHLDNSSP GPGSEARGIN
410 420 430 440 450
GGPSRMSPKA QRPLRGAKTL SSPSNRPSGE ASVPPTSAAL PFLPVGRMYP
460 470 480 490 500
PRSPKSAAPA PVSASCPEPP IGSAVASSAS IPVTSSVVDP GAGSISPASP
510 520 530 540 550
KLSLTPTDVK ELPTKEPSRN LEAQELARIA GKVPGLQNEQ KRFQLEELRK
560 570 580 590 600
FGAQFKLQPS SSPETGLDPF PSRILKEEAK GKEKEVDGLL TSDPMGSPVS
610 620 630 640 650
SKTESILDKE DKVPMAGVGG TEGPEQLPAP CPSQTGSPPV GLIKGDEKEE
660 670 680 690 700
GPVTEQVKKS TLNPNAKEFN PTKPLLSVNK STSTPTSPGP RTHSTPSIPV
710 720 730 740 750
LTAGQSGLYS PQYISYIPQI HMGPAVQAPQ MYPYPVSNSV PGQQGKYRGA
760 770 780 790 800
KGSLPPQRSD QHQPASAPPM MQAAAAAAGP PLVAATPYSS YIPYNPQQFP
810 820 830 840 850
GQPAMMQPMA HYPSQPVFAP MLQSNPRMLT SGSHPQAIVS SSTPQYPAAE
860 870 880 890 900
QPTPQALYAT VHQSYPHHAT QLHGHQPQPA TTPTGSQPQS QHAAPSPVQH
910 920 930 940 950
QAGQAPHLGS GQPQQNLYHP GALTGTPPSL PPGPSAQSPQ SSFPQPAAVY
960 970 980 990 1000
AIHPHQQLPH GFTNMAHVTQ AHVQTGVTAA PPPHPGAPHP PQVMLLHPPQ
1010 1020 1030 1040
GHGGPPQGAV PPSGVPALSA STPSPYPYIG HPQVQSHPSQ QLPFHPPGN
Length:1,049
Mass (Da):110,649
Last modified:October 1, 2003 - v1
Checksum:i27ECCFE500688D45
GO
Isoform 2 (identifier: Q7TQH0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     439-444: Missing.
     1034-1049: VQSHPSQQLPFHPPGN → GEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGD

Note: No experimental confirmation available.
Show »
Length:1,074
Mass (Da):113,043
Checksum:iB1D4892E2506AC59
GO
Isoform 3 (identifier: Q7TQH0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     439-444: Missing.

Note: No experimental confirmation available.
Show »
Length:1,043
Mass (Da):110,010
Checksum:i0CC40AF28EEB87BE
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3TGG2Q3TGG2_MOUSE
Ataxin-2-like protein
Atxn2l
994Annotation score:
A0A0U1RPL0A0A0U1RPL0_MOUSE
Ataxin-2-like protein
Atxn2l
1,096Annotation score:
E9Q5Q0E9Q5Q0_MOUSE
Ataxin-2-like protein
Atxn2l
863Annotation score:
J3QP59J3QP59_MOUSE
Ataxin-2-like protein
Atxn2l
218Annotation score:
A0A0U1RNZ9A0A0U1RNZ9_MOUSE
Ataxin-2-like protein
Atxn2l
144Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_011595439 – 444Missing in isoform 2 and isoform 3. 1 Publication6
Alternative sequenceiVSP_0115961034 – 1049VQSHP…HPPGN → GEQPGQAPGFPGGADDRIRE FSLAGGIWHGRAEGLQVGQD ARVLGGD in isoform 2. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC034083 mRNA Translation: AAH34083.1
BC043451 mRNA Translation: AAH43451.1
BC054483 mRNA Translation: AAH54483.1
CCDSiCCDS21831.1 [Q7TQH0-1]
RefSeqiNP_898841.1, NM_183020.1 [Q7TQH0-1]
XP_006507788.1, XM_006507725.2 [Q7TQH0-3]
UniGeneiMm.231450

Genome annotation databases

EnsembliENSMUST00000040202; ENSMUSP00000035415; ENSMUSG00000032637 [Q7TQH0-1]
GeneIDi233871
KEGGimmu:233871
UCSCiuc009jrr.1 mouse [Q7TQH0-3]
uc009jrs.1 mouse [Q7TQH0-1]
uc009jru.1 mouse [Q7TQH0-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC034083 mRNA Translation: AAH34083.1
BC043451 mRNA Translation: AAH43451.1
BC054483 mRNA Translation: AAH54483.1
CCDSiCCDS21831.1 [Q7TQH0-1]
RefSeqiNP_898841.1, NM_183020.1 [Q7TQH0-1]
XP_006507788.1, XM_006507725.2 [Q7TQH0-3]
UniGeneiMm.231450

3D structure databases

ProteinModelPortaliQ7TQH0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi231460, 3 interactors
IntActiQ7TQH0, 3 interactors
MINTiQ7TQH0
STRINGi10090.ENSMUSP00000035415

PTM databases

iPTMnetiQ7TQH0
PhosphoSitePlusiQ7TQH0

Proteomic databases

PaxDbiQ7TQH0
PeptideAtlasiQ7TQH0
PRIDEiQ7TQH0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000040202; ENSMUSP00000035415; ENSMUSG00000032637 [Q7TQH0-1]
GeneIDi233871
KEGGimmu:233871
UCSCiuc009jrr.1 mouse [Q7TQH0-3]
uc009jrs.1 mouse [Q7TQH0-1]
uc009jru.1 mouse [Q7TQH0-2]

Organism-specific databases

CTDi11273
MGIiMGI:2446242 Atxn2l

Phylogenomic databases

eggNOGiKOG2375 Eukaryota
COG5180 LUCA
GeneTreeiENSGT00530000063565
HOGENOMiHOG000234354
HOVERGENiHBG050623
InParanoidiQ7TQH0
OrthoDBiEOG091G01U5
PhylomeDBiQ7TQH0
TreeFamiTF326591

Miscellaneous databases

ChiTaRSiAtxn2l mouse
PMAP-CutDBiQ7TQH0
PROiPR:Q7TQH0
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000032637 Expressed in 234 organ(s), highest expression level in rostral migratory stream
CleanExiMM_ATXN2L
ExpressionAtlasiQ7TQH0 baseline and differential
GenevisibleiQ7TQH0 MM

Family and domain databases

InterProiView protein in InterPro
IPR009818 Ataxin-2_C
IPR009604 LsmAD_domain
IPR025852 SM_dom_ATX
PfamiView protein in Pfam
PF06741 LsmAD, 1 hit
PF07145 PAM2, 1 hit
PF14438 SM-ATX, 1 hit
SMARTiView protein in SMART
SM01272 LsmAD, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiATX2L_MOUSE
AccessioniPrimary (citable) accession number: Q7TQH0
Secondary accession number(s): Q80XN9, Q8K059
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: October 1, 2003
Last modified: November 7, 2018
This is version 116 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again