Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).
Entry version 152 (07 Apr 2021)
Sequence version 2 (16 Jan 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Peripheral-type benzodiazepine receptor-associated protein 1

Gene

Tspoap1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-181429, Serotonin Neurotransmitter Release Cycle
R-MMU-181430, Norepinephrine Neurotransmitter Release Cycle
R-MMU-196108, Pregnenolone biosynthesis
R-MMU-210500, Glutamate Neurotransmitter Release Cycle
R-MMU-212676, Dopamine Neurotransmitter Release Cycle
R-MMU-264642, Acetylcholine Neurotransmitter Release Cycle

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Peripheral-type benzodiazepine receptor-associated protein 1
Short name:
PRAX-1
Alternative name(s):
Peripheral benzodiazepine receptor-interacting protein
Short name:
PBR-IP
RIMS-binding protein 1
Short name:
RIM-BP1
TSPO-associated protein 1By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Tspoap1By similarity
Synonyms:Bzrap1, Kiaa0612, Rbp1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2450877, Tspoap1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Mitochondrion

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002213811 – 1846Peripheral-type benzodiazepine receptor-associated protein 1Add BLAST1846

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7TNF8

PRoteomics IDEntifications database

More...
PRIDEi
Q7TNF8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
255217 [Q7TNF8-1]
255218 [Q7TNF8-2]
255219 [Q7TNF8-3]
255220 [Q7TNF8-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7TNF8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7TNF8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in the brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000034156, Expressed in brain and 177 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7TNF8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7TNF8, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RIMS1, RIMS2 and TSPO.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000048063

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q7TNF8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7TNF8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini649 – 716SH3 1PROSITE-ProRule annotationAdd BLAST68
Domaini787 – 878Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST92
Domaini880 – 972Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST93
Domaini977 – 1075Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST99
Domaini1616 – 1684SH3 2PROSITE-ProRule annotationAdd BLAST69
Domaini1755 – 1822SH3 3PROSITE-ProRule annotationAdd BLAST68

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1067 – 1142Pro-richAdd BLAST76
Compositional biasi1254 – 1265Poly-GluAdd BLAST12
Compositional biasi1325 – 1334Poly-Glu10

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SH3 and proline-rich domain is required for the interaction with TSPO and the second SH3 domain mediates binding to a proline-rich motif in RIMS1 and RIMS2.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the RIMBP family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3632, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183203

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001979_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7TNF8

Database of Orthologous Groups

More...
OrthoDBi
102427at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7TNF8

TreeFam database of animal gene trees

More...
TreeFami
TF316230

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063, FN3, 1 hit
cd12012, SH3_RIM-BP_2, 1 hit
cd12013, SH3_RIM-BP_3, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR013783, Ig-like_fold
IPR035753, RIM-BP_SH3_2
IPR035755, RIM-BP_SH3_3
IPR040325, RIMBP1/2/3
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain

The PANTHER Classification System

More...
PANTHERi
PTHR14234, PTHR14234, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07653, SH3_2, 2 hits
PF14604, SH3_9, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060, FN3, 3 hits
SM00326, SH3, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49265, SSF49265, 1 hit
SSF50044, SSF50044, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853, FN3, 3 hits
PS50002, SH3, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7TNF8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQLTTLPRL GDLGAMEPWA LPAWQHWTQG QGCKPGDASP SIAGTPTALQ
60 70 80 90 100
VKGLRFEESS KPEGAHSPGP VGNTDPEATE TGLPKLGQQA ESPGYSCSGL
110 120 130 140 150
EEEEAQAYKA KFNIGFGDRP NLELLRALGE LQQRCTILKE ENQMLRKSSF
160 170 180 190 200
PETEEKVRRL KRKNAELAVI AKRLEERAQK LQETNMRVVS APVPRPGSSL
210 220 230 240 250
ELCRKALARQ RARDLSETAS ALLAKDKQIA ALQRECRELQ ARLSLVGKEG
260 270 280 290 300
PQWLHMRDFD RLLRESQREV LRLQRQIALR NQREPLRPAR SPGPTAPSRV
310 320 330 340 350
GAPAPGAPGE AVLQDDVESP QVVLREPEKQ QRVQQLESEL CKKRKKCESL
360 370 380 390 400
EQEARKKQRR CEELELQLRA AQNENARLVE ENSRLSGRAT EKEQVEWENS
410 420 430 440 450
ELKGQLLGVT QERDSALLKS QGLQSKLESL EQVLKHMREV AQRRQQLEVE
460 470 480 490 500
HEQARLSLQE KQEEVRRLQQ AQAEAKREHE GAVQLLESTL DSMQARVREL
510 520 530 540 550
EGQCRSQTER FSLLAQELQA FRLHPGPLDL LTSALGCSAL GDHPPPHCCC
560 570 580 590 600
SIPQPCQGSG PKDLDLPPGS PGRCTPKSSE PALTTLTGIP RRTAKKAESL
610 620 630 640 650
SNSSRSESIH NSPKSCPTPE VDTASEVEEL EVDSVSLLPA APESHSGGAR
660 670 680 690 700
IQVFLARYSY NPFEGPNENP EAELPLTAGE YIYIYGNMDE DGFFEGELMD
710 720 730 740 750
GRRGLVPSNF VERVSDDDLL STLPRELADS SHSSGPELSF LSGGGGGCSS
760 770 780 790 800
GGQSSGGRSQ PRPEEEAAGD ELSLSPPPEG LGEPLAVPYP RHITVLKQLA
810 820 830 840 850
HSVVLAWELP PERVDLRGFH IFVNGELRQA LGPGVPPKAV LENMDLRTGP
860 870 880 890 900
LHVSVQALTS KGSSDPLRCC LAVGAGAGVV PSQLRIHRLT ATSAEIAWVP
910 920 930 940 950
GNSNLAHAIY LNGEECPPAR PSTYWATFCN LRPGTLYQAR VEAQIPSQGP
960 970 980 990 1000
WEPGWERPEQ RAATLQFTTL PAGLPDAPLD VQAEPGPSPG ILMISWLPVT
1010 1020 1030 1040 1050
IDAAGTSNGV RVTGYAIYAD GQKIMEVASP TAGSVLVEVS QLQLLQACHE
1060 1070 1080 1090 1100
VTVRTMSPHG ESSDSIPAPV APALASACQP ARMSCLSPRP SPEVRTPLAS
1110 1120 1130 1140 1150
VSPGLGDTSF PLRHPVPHGT QDFSASLSIE MSKGPQEEPP VPCSQEEAGA
1160 1170 1180 1190 1200
AVRSISEEKR AIEPTLGQEG PEPVAPSLAK QEVECTSGDA GPVPCSTQGE
1210 1220 1230 1240 1250
LTQKKPSIEA CHGGDLDSGL KLRSEKEDMS ELGVHLVNSL VDHSRNSDLS
1260 1270 1280 1290 1300
DIQEEEEEEE EEEEELGSRP CSSQKQVAGN SIRENGAKPQ PDPFCETDSD
1310 1320 1330 1340 1350
EEILEQILEL PLQRLCSKKL FSIPEEEEEE EEEEGLEKPG PSRTSQDPSQ
1360 1370 1380 1390 1400
PELALLGPGC DSSQPQGPGL CPLSPELSGV REHLEDVLGV VGGNGRRRGG
1410 1420 1430 1440 1450
GSPEKLPNRK RPQDPREHCS RLLGNGGPQA SARPVPPRER GSLPVIEGTR
1460 1470 1480 1490 1500
VGQEPGGRGR PGLSRRCPRG PAPESSLVSC LSPKCLEISI EYDSEDEQEA
1510 1520 1530 1540 1550
GSGGVSINSS CYPTDGEAWG TAAVGRPRGP PKVNPGPNAY LRLPAWEKGE
1560 1570 1580 1590 1600
PERRGRSAIG RTKEPPSRAT ETGESRGQDN SGRRGPQRRG ARVPRSGTTE
1610 1620 1630 1640 1650
LAPPRSPQEA PPHQDLPVRV FVALFDYDPV SMSPNPDAGE EELPFKEGQL
1660 1670 1680 1690 1700
LKVFGDKDAD GFYRGESGGR TGYIPCNMVA EVAVDSPAGR QQLLQRGFLP
1710 1720 1730 1740 1750
PNVLTEASGN GPSVYSSAHT PGPPPKPRRS KKVELEGPTQ LCPGPPKLIH
1760 1770 1780 1790 1800
SAAQKTSRPM VAAFDYNPRE NSPNMDVEAE LPFRAGDVIT VFGNMDDDGF
1810 1820 1830 1840
YYGELNGQRG LVPSNFLEGP GPESGSLESG TSQAESQRTR RRRVQC
Length:1,846
Mass (Da):199,929
Last modified:January 16, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD53D1ED33376134D
GO
Isoform 2 (identifier: Q7TNF8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1289-1568: Missing.

Show »
Length:1,566
Mass (Da):169,900
Checksum:iB3A4D6823AE13194
GO
Isoform 3 (identifier: Q7TNF8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1631: Missing.
     1838-1846: RTRRRRVQC → DPRITIQGPPVPPGWHCALSSGSSSRTKLGESQSIAEKKQGLLAKAKELLKRLGSRKD

Show »
Length:264
Mass (Da):28,159
Checksum:i36D345DD9D26F004
GO
Isoform 4 (identifier: Q7TNF8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1481-1568: LSPKCLEISI...IGRTKEPPSR → QETVLSHSPW...PLPSVALSLQ
     1803-1846: GELNGQRGLVPSNFLEGPGPESGSLESGTSQAESQRTRRRRVQC → VRSSWGKEGVLCSGSPAGHAYGQTFLAEGWR

Note: Due to intron retention.Curated
Show »
Length:1,833
Mass (Da):198,241
Checksum:iD3F940AF95D6CF74
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5NCP6Q5NCP6_MOUSE
Peripheral-type benzodiazepine rece...
Tspoap1 Bzrap1
1,786Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6WV49F6WV49_MOUSE
Peripheral-type benzodiazepine rece...
Tspoap1 Bzrap1
384Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7AUI0F7AUI0_MOUSE
Peripheral-type benzodiazepine rece...
Tspoap1 Bzrap1
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7CD74F7CD74_MOUSE
Peripheral-type benzodiazepine rece...
Tspoap1 Bzrap1
251Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1715Y → C in BAC34805 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0092061 – 1631Missing in isoform 3. 1 PublicationAdd BLAST1631
Alternative sequenceiVSP_0092071289 – 1568Missing in isoform 2. 1 PublicationAdd BLAST280
Alternative sequenceiVSP_0092081481 – 1568LSPKC…EPPSR → QETVLSHSPWPLQAPLLHSS IGELGASARPSTVGVSGTSA RLGQAPGEEFCAPVLMCCLR CRRGQSRGVWATTEDSVSPL PSVALSLQ in isoform 4. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_0092091803 – 1846GELNG…RRVQC → VRSSWGKEGVLCSGSPAGHA YGQTFLAEGWR in isoform 4. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_0092101838 – 1846RTRRRRVQC → DPRITIQGPPVPPGWHCALS SGSSSRTKLGESQSIAEKKQ GLLAKAKELLKRLGSRKD in isoform 3. 1 Publication9

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK051895 mRNA Translation: BAC34805.1
AL604022 Genomic DNA No translation available.
BC055691 mRNA Translation: AAH55691.1
AK122329 mRNA Translation: BAC65611.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS48879.1 [Q7TNF8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_766037.2, NM_172449.2 [Q7TNF8-1]
XP_006532773.1, XM_006532710.3 [Q7TNF8-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000039627; ENSMUSP00000048063; ENSMUSG00000034156 [Q7TNF8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
207777

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:207777

UCSC genome browser

More...
UCSCi
uc007kum.2, mouse [Q7TNF8-1]
uc007kup.2, mouse [Q7TNF8-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK051895 mRNA Translation: BAC34805.1
AL604022 Genomic DNA No translation available.
BC055691 mRNA Translation: AAH55691.1
AK122329 mRNA Translation: BAC65611.1
CCDSiCCDS48879.1 [Q7TNF8-1]
RefSeqiNP_766037.2, NM_172449.2 [Q7TNF8-1]
XP_006532773.1, XM_006532710.3 [Q7TNF8-2]

3D structure databases

SMRiQ7TNF8
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000048063

PTM databases

iPTMnetiQ7TNF8
PhosphoSitePlusiQ7TNF8

Proteomic databases

PaxDbiQ7TNF8
PRIDEiQ7TNF8
ProteomicsDBi255217 [Q7TNF8-1]
255218 [Q7TNF8-2]
255219 [Q7TNF8-3]
255220 [Q7TNF8-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
18369, 24 antibodies

Genome annotation databases

EnsembliENSMUST00000039627; ENSMUSP00000048063; ENSMUSG00000034156 [Q7TNF8-1]
GeneIDi207777
KEGGimmu:207777
UCSCiuc007kum.2, mouse [Q7TNF8-1]
uc007kup.2, mouse [Q7TNF8-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9256
MGIiMGI:2450877, Tspoap1

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG3632, Eukaryota
GeneTreeiENSGT00950000183203
HOGENOMiCLU_001979_1_0_1
InParanoidiQ7TNF8
OrthoDBi102427at2759
PhylomeDBiQ7TNF8
TreeFamiTF316230

Enzyme and pathway databases

ReactomeiR-MMU-181429, Serotonin Neurotransmitter Release Cycle
R-MMU-181430, Norepinephrine Neurotransmitter Release Cycle
R-MMU-196108, Pregnenolone biosynthesis
R-MMU-210500, Glutamate Neurotransmitter Release Cycle
R-MMU-212676, Dopamine Neurotransmitter Release Cycle
R-MMU-264642, Acetylcholine Neurotransmitter Release Cycle

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
207777, 2 hits in 53 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Rbp1, mouse

Protein Ontology

More...
PROi
PR:Q7TNF8
RNActiQ7TNF8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000034156, Expressed in brain and 177 other tissues
ExpressionAtlasiQ7TNF8, baseline and differential
GenevisibleiQ7TNF8, MM

Family and domain databases

CDDicd00063, FN3, 1 hit
cd12012, SH3_RIM-BP_2, 1 hit
cd12013, SH3_RIM-BP_3, 1 hit
Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR013783, Ig-like_fold
IPR035753, RIM-BP_SH3_2
IPR035755, RIM-BP_SH3_3
IPR040325, RIMBP1/2/3
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
PANTHERiPTHR14234, PTHR14234, 1 hit
PfamiView protein in Pfam
PF07653, SH3_2, 2 hits
PF14604, SH3_9, 1 hit
SMARTiView protein in SMART
SM00060, FN3, 3 hits
SM00326, SH3, 3 hits
SUPFAMiSSF49265, SSF49265, 1 hit
SSF50044, SSF50044, 3 hits
PROSITEiView protein in PROSITE
PS50853, FN3, 3 hits
PS50002, SH3, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRIMB1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7TNF8
Secondary accession number(s): Q5NCP7, Q80TV9, Q8BIH5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 16, 2004
Last sequence update: January 16, 2004
Last modified: April 7, 2021
This is version 152 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again