Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 149 (02 Jun 2021)
Sequence version 2 (24 Jul 2007)
Previous versions | rss
Add a publicationFeedback
Protein

NLR family CARD domain-containing protein 3

Gene

NLRC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Negative regulator of the innate immune response (PubMed:15705585, PubMed:22863753, PubMed:25277106).

Attenuates signaling pathways activated by Toll-like receptors (TLRs) and the DNA sensor STING/TMEM173 in response to pathogen-associated molecular patterns, such as intracellular poly(dA:dT), but not poly(I:C), or in response to DNA virus infection, including that of Herpes simplex virus 1 (HSV1) (By similarity) (PubMed:22863753).

May affect TLR4 signaling by acting at the level of TRAF6 ubiquitination, decreasing the activating 'Lys-63'-linked ubiquitination and leaving unchanged the degradative 'Lys-48'-linked ubiquitination (PubMed:22863753).

Inhibits the PI3K-AKT-mTOR pathway possibly by directly interacting with the posphatidylinositol 3-kinase regulatory subunit p85 (PIK3R1/PIK3R2) and disrupting the association between PIK3R1/PIK3R2 and the catalytic subunit p110 (PIK3CA/PIK3CB/PIK3CD) and reducing PIK3R1/PIK3R2 activation. Via its regulation of the PI3K-AKT-mTOR pathway, controls cell proliferation, predominantly in intestinal epithelial cells (By similarity).

May also affect NOD1- or NOD2-mediated NF-kappa-B activation (PubMed:25277106).

Might also affect the inflammatory response by preventing NLRP3 inflammasome formation, CASP1 cleavage and IL1B maturation (PubMed:25277106).

By similarity3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi145 – 152ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q7RTR2

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-3270619, IRF3-mediated induction of type I IFN

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NLR family CARD domain-containing protein 3
Alternative name(s):
CARD15-like protein
Caterpiller protein 16.21 Publication
Short name:
CLR16.21 Publication
NACHT, LRR and CARD domains-containing protein 3
Nucleotide-binding oligomerization domain protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NLRC3
Synonyms:NOD3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29889, NLRC3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615648, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7RTR2

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000167984.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi457 – 460SLQE → AAAA: Strong decrease of TRAF6-binding. 1 Publication4
Mutagenesisi582 – 585SVEE → AAAA: Almost no effect on TRAF6-binding. 1 Publication4

Organism-specific databases

DisGeNET

More...
DisGeNETi
197358

Open Targets

More...
OpenTargetsi
ENSG00000167984

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162397626

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q7RTR2, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NLRC3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002961871 – 1065NLR family CARD domain-containing protein 3Add BLAST1065

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q7RTR2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q7RTR2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q7RTR2

PeptideAtlas

More...
PeptideAtlasi
Q7RTR2

PRoteomics IDEntifications database

More...
PRIDEi
Q7RTR2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
68886 [Q7RTR2-1]
68887 [Q7RTR2-2]
68888 [Q7RTR2-3]
68889 [Q7RTR2-4]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q7RTR2-3 [Q7RTR2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7RTR2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7RTR2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

In primary T-cells, down-regulated upon T-cell receptor activation (PubMed:15705585). Down-regulated in peritoneal macrophages soon after the beginning of LPS stimulation. Levels start increasing again after 3 days of LPS treatment (PubMed:22863753).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000167984, Expressed in blood and 151 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7RTR2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7RTR2, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000167984, Tissue enriched (lymphoid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Directly interacts (via CARD) with TMEM173/STING; this interaction reduces TMEM173 trafficking to the perinuclear region in response to interferon stimulatory DNA.

Also interacts, but to a lesser extent, with TBK1 (PubMed:24560620).

Interacts with TRAF6; this interaction results in decreased TRAF6 'Lys-63'-linked polyubiquitination, but leaves 'Lys-48'-linked chains unchanged, promoting TRAF6 protein degradation (PubMed:22863753).

Interacts with PIK3R1/PIK3R2; this interaction disrupts the association between PIK3R1/PIK3R2 and the p110 catalytic subunit PIK3CA/PIK3CB/PIK3CD and reduces PIK3R1/PIK3R2 activation (By similarity). Weakly interacts with PYCARD/ASC.

Interacts with CASP1 and CASP5 (PubMed:25277106).

By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
128254, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q7RTR2, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000352039

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q7RTR2, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini139 – 460NACHTPROSITE-ProRule annotationAdd BLAST322
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati617 – 639LRR 1Add BLAST23
Repeati641 – 663LRR 2Add BLAST23
Repeati665 – 688LRR 3Add BLAST24
Repeati693 – 716LRR 4Add BLAST24
Repeati721 – 744LRR 5Add BLAST24
Repeati749 – 772LRR 6Add BLAST24
Repeati777 – 800LRR 7Add BLAST24
Repeati805 – 828LRR 8Add BLAST24
Repeati833 – 856LRR 9Add BLAST24
Repeati861 – 884LRR 10Add BLAST24
Repeati889 – 912LRR 11Add BLAST24
Repeati917 – 940LRR 12Add BLAST24
Repeati945 – 968LRR 13Add BLAST24
Repeati973 – 996LRR 14Add BLAST24
Repeati1001 – 1029LRR 15Add BLAST29
Repeati1031 – 1052LRR 16Add BLAST22

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 62DisorderedSequence analysisAdd BLAST62

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi457 – 460TRAF6-binding1 Publication4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The leucine-rich repeat domain may reduce the interaction with TMEM173/STING.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NLRP family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4308, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159861

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002274_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7RTR2

Database of Orthologous Groups

More...
OrthoDBi
259987at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7RTR2

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.80.10.10, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001611, Leu-rich_rpt
IPR032675, LRR_dom_sf
IPR007111, NACHT_NTPase
IPR041267, NLRP_HD2
IPR041075, NOD2_WH

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13516, LRR_6, 12 hits
PF05729, NACHT, 1 hit
PF17776, NLRC4_HD2, 1 hit
PF17779, NOD2_WH, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50837, NACHT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7RTR2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRKQEVRTGR EAGQGHGTGS PAEQVKALMD LLAGKGSQGS QAPQALDRTP
60 70 80 90 100
DAPLGPCSND SRIQRHRKAL LSKVGGGPEL GGPWHRLASL LLVEGLTDLQ
110 120 130 140 150
LREHDFTQVE ATRGGGHPAR TVALDRLFLP LSRVSVPPRV SITIGVAGMG
160 170 180 190 200
KTTLVRHFVR LWAHGQVGKD FSLVLPLTFR DLNTHEKLCA DRLICSVFPH
210 220 230 240 250
VGEPSLAVAV PARALLILDG LDECRTPLDF SNTVACTDPK KEIPVDHLIT
260 270 280 290 300
NIIRGNLFPE VSIWITSRPS ASGQIPGGLV DRMTEIRGFN EEEIKVCLEQ
310 320 330 340 350
MFPEDQALLG WMLSQVQADR ALYLMCTVPA FCRLTGMALG HLWRSRTGPQ
360 370 380 390 400
DAELWPPRTL CELYSWYFRM ALSGEGQEKG KASPRIEQVA HGGRKMVGTL
410 420 430 440 450
GRLAFHGLLK KKYVFYEQDM KAFGVDLALL QGAPCSCFLQ REETLASSVA
460 470 480 490 500
YCFTHLSLQE FVAAAYYYGA SRRAIFDLFT ESGVSWPRLG FLTHFRSAAQ
510 520 530 540 550
RAMQAEDGRL DVFLRFLSGL LSPRVNALLA GSLLAQGEHQ AYRTQVAELL
560 570 580 590 600
QGCLRPDAAV CARAINVLHC LHELQHTELA RSVEEAMESG ALARLTGPAH
610 620 630 640 650
RAALAYLLQV SDACAQEANL SLSLSQGVLQ SLLPQLLYCR KLRLDTNQFQ
660 670 680 690 700
DPVMELLGSV LSGKDCRIQK ISLAENQISN KGAKALARSL LVNRSLTSLD
710 720 730 740 750
LRGNSIGPQG AKALADALKI NRTLTSLSLQ GNTVRDDGAR SMAEALASNR
760 770 780 790 800
TLSMLHLQKN SIGPMGAQRM ADALKQNRSL KELMFSSNSI GDGGAKALAE
810 820 830 840 850
ALKVNQGLES LDLQSNSISD AGVAALMGAL CTNQTLLSLS LRENSISPEG
860 870 880 890 900
AQAIAHALCA NSTLKNLDLT ANLLHDQGAR AIAVAVRENR TLTSLHLQWN
910 920 930 940 950
FIQAGAAQAL GQALQLNRSL TSLDLQENAI GDDGACAVAR ALKVNTALTA
960 970 980 990 1000
LYLQVASIGA SGAQVLGEAL AVNRTLEILD LRGNAIGVAG AKALANALKV
1010 1020 1030 1040 1050
NSSLRRLNLQ ENSLGMDGAI CIATALSGNH RLQHINLQGN HIGDSGARMI
1060
SEAIKTNAPT CTVEM
Length:1,065
Mass (Da):114,658
Last modified:July 24, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9BFFCB21FD134562
GO
Isoform 2 (identifier: Q7RTR2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEMDAPRPPSLAVPGAASRPGRLLDGGHGRQQVQALSSQLLEVIPDS

Show »
Length:1,111
Mass (Da):119,415
Checksum:iFEE1E4406C56A5B4
GO
Isoform 3 (identifier: Q7RTR2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     728-761: SLQGNTVRDDGARSMAEALASNRTLSMLHLQKNS → RVKFMYHKIDCFRRVPEADACNPSTLGGQGRWIT
     762-1065: Missing.

Show »
Length:761
Mass (Da):83,456
Checksum:iD15C62D5D14362DF
GO
Isoform 4 (identifier: Q7RTR2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     869-896: Missing.

Show »
Length:1,037
Mass (Da):111,634
Checksum:i3773D36A3AA54050
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BLT9H3BLT9_HUMAN
NLR family CARD domain-containing p...
NLRC3 NOD3, hCG_2036791
1,112Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WZ24A0A087WZ24_HUMAN
NLR family CARD domain-containing p...
NLRC3
196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC03412 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti41Q → H in DAA01245 (PubMed:12766759).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034606567V → M. Corresponds to variant dbSNP:rs8057436Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0271351M → MEMDAPRPPSLAVPGAASRP GRLLDGGHGRQQVQALSSQL LEVIPDS in isoform 2. 1 Publication1
Alternative sequenceiVSP_027136728 – 761SLQGN…LQKNS → RVKFMYHKIDCFRRVPEADA CNPSTLGGQGRWIT in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_027137762 – 1065Missing in isoform 3. 1 PublicationAdd BLAST304
Alternative sequenceiVSP_027138869 – 896Missing in isoform 4. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BK001112 mRNA Translation: DAA01245.1
AY601811 mRNA Translation: AAT48367.1
AK090431 mRNA Translation: BAC03412.1 Different initiation.
AK074109 mRNA Translation: BAB84935.1
AF501291 mRNA Translation: AAM22459.1
AF501292 mRNA Translation: AAM22460.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS73817.1 [Q7RTR2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_849172.2, NM_178844.3 [Q7RTR2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000359128; ENSP00000352039; ENSG00000167984 [Q7RTR2-1]
ENST00000615877; ENSP00000482989; ENSG00000167984 [Q7RTR2-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
197358

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:197358

UCSC genome browser

More...
UCSCi
uc032dpc.2, human [Q7RTR2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BK001112 mRNA Translation: DAA01245.1
AY601811 mRNA Translation: AAT48367.1
AK090431 mRNA Translation: BAC03412.1 Different initiation.
AK074109 mRNA Translation: BAB84935.1
AF501291 mRNA Translation: AAM22459.1
AF501292 mRNA Translation: AAM22460.1
CCDSiCCDS73817.1 [Q7RTR2-1]
RefSeqiNP_849172.2, NM_178844.3 [Q7RTR2-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi128254, 5 interactors
IntActiQ7RTR2, 3 interactors
STRINGi9606.ENSP00000352039

PTM databases

iPTMnetiQ7RTR2
PhosphoSitePlusiQ7RTR2

Genetic variation databases

BioMutaiNLRC3

Proteomic databases

jPOSTiQ7RTR2
MassIVEiQ7RTR2
MaxQBiQ7RTR2
PeptideAtlasiQ7RTR2
PRIDEiQ7RTR2
ProteomicsDBi68886 [Q7RTR2-1]
68887 [Q7RTR2-2]
68888 [Q7RTR2-3]
68889 [Q7RTR2-4]
TopDownProteomicsiQ7RTR2-3 [Q7RTR2-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
56241, 51 antibodies

The DNASU plasmid repository

More...
DNASUi
197358

Genome annotation databases

EnsembliENST00000359128; ENSP00000352039; ENSG00000167984 [Q7RTR2-1]
ENST00000615877; ENSP00000482989; ENSG00000167984 [Q7RTR2-3]
GeneIDi197358
KEGGihsa:197358
UCSCiuc032dpc.2, human [Q7RTR2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
197358
DisGeNETi197358

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NLRC3
HGNCiHGNC:29889, NLRC3
HPAiENSG00000167984, Tissue enriched (lymphoid)
MIMi615648, gene
neXtProtiNX_Q7RTR2
OpenTargetsiENSG00000167984
PharmGKBiPA162397626
VEuPathDBiHostDB:ENSG00000167984.16

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4308, Eukaryota
GeneTreeiENSGT00940000159861
HOGENOMiCLU_002274_3_0_1
InParanoidiQ7RTR2
OrthoDBi259987at2759
PhylomeDBiQ7RTR2

Enzyme and pathway databases

PathwayCommonsiQ7RTR2
ReactomeiR-HSA-3270619, IRF3-mediated induction of type I IFN

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
197358, 3 hits in 185 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NLRC3, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NLRC3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
197358
PharosiQ7RTR2, Tbio

Protein Ontology

More...
PROi
PR:Q7RTR2
RNActiQ7RTR2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000167984, Expressed in blood and 151 other tissues
ExpressionAtlasiQ7RTR2, baseline and differential
GenevisibleiQ7RTR2, HS

Family and domain databases

Gene3Di3.80.10.10, 4 hits
InterProiView protein in InterPro
IPR001611, Leu-rich_rpt
IPR032675, LRR_dom_sf
IPR007111, NACHT_NTPase
IPR041267, NLRP_HD2
IPR041075, NOD2_WH
PfamiView protein in Pfam
PF13516, LRR_6, 12 hits
PF05729, NACHT, 1 hit
PF17776, NLRC4_HD2, 1 hit
PF17779, NOD2_WH, 1 hit
PROSITEiView protein in PROSITE
PS50837, NACHT, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNLRC3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7RTR2
Secondary accession number(s): Q5EY36
, Q8NF48, Q8NI01, Q8NI02, Q8TEL3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: July 24, 2007
Last modified: June 2, 2021
This is version 149 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again