Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 169 (13 Nov 2019)
Sequence version 2 (13 Jul 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

[F-actin]-monooxygenase MICAL3

Gene

MICAL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin to form methionine-sulfoxide, resulting in actin filament disassembly and preventing repolymerization. In the absence of actin, it also functions as a NADPH oxidase producing H2O2. Seems to act as Rab effector protein and plays a role in vesicle trafficking. Involved in exocytic vesicles tethering and fusion: the monooxygenase activity is required for this process and implicates RAB8A associated with exocytotic vesicles. Required for cytokinesis. Contributes to stabilization and/or maturation of the intercellular bridge independently of its monooxygenase activity. Promotes recruitment of Rab8 and ERC1 to the intercellular bridge, and together these proteins are proposed to function in timely abscission.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

FADBy similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei97FADBy similarity1
Binding sitei183FAD; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei298FADBy similarity1
Binding sitei398FADBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi764Zinc 1By similarity1
Metal bindingi767Zinc 1By similarity1
Metal bindingi785Zinc 1; via pros nitrogenBy similarity1
Metal bindingi788Zinc 1By similarity1
Metal bindingi791Zinc 2By similarity1
Metal bindingi794Zinc 2By similarity1
Metal bindingi814Zinc 2By similarity1
Metal bindingi817Zinc 2; via pros nitrogenBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi116 – 118FADBy similarity3
Nucleotide bindingi123 – 125FADBy similarity3

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Monooxygenase, Oxidoreductase
Biological processCell cycle, Cell division, Exocytosis
LigandFAD, Flavoprotein, Metal-binding, NADP, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
[F-actin]-monooxygenase MICAL3 (EC:1.14.13.2251 Publication)
Alternative name(s):
Molecule interacting with CasL protein 3
Short name:
MICAL-3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MICAL3
Synonyms:KIAA0819, KIAA1364
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24694 MICAL3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608882 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7RTP6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi93 – 98GAGPCG → WAWPCW: Abolishes Monooxygenase activity and impairs ability to control docking and fusion of exocytic carriers. 1 Publication6
Mutagenesisi680 – 683KRRK → AAAA in MICAL-3NLSMut; abolishes nuclear localization. 1 Publication4

Organism-specific databases

DisGeNET

More...
DisGeNETi
57553

Open Targets

More...
OpenTargetsi
ENSG00000243156

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671454

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q7RTP6

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MICAL3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
300669653

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000758461 – 2002[F-actin]-monooxygenase MICAL3Add BLAST2002

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei649PhosphoserineCombined sources1
Modified residuei685PhosphoserineBy similarity1
Modified residuei687PhosphoserineBy similarity1
Modified residuei887PhosphothreonineCombined sources1
Modified residuei977PhosphoserineBy similarity1
Modified residuei1134PhosphoserineCombined sources1
Modified residuei1143PhosphoserineCombined sources1
Modified residuei1160PhosphoserineCombined sources1
Modified residuei1192PhosphoserineBy similarity1
Modified residuei1274PhosphoserineCombined sources1
Modified residuei1276PhosphothreonineCombined sources1
Modified residuei1278PhosphoserineCombined sources1
Modified residuei1310PhosphoserineCombined sources1
Modified residuei1337PhosphoserineCombined sources1
Modified residuei1341PhosphothreonineCombined sources1
Modified residuei1371PhosphoserineCombined sources1
Modified residuei1384PhosphoserineCombined sources1
Modified residuei1433PhosphoserineCombined sources1
Modified residuei1454PhosphothreonineCombined sources1
Modified residuei1649PhosphoserineCombined sources1
Modified residuei1651PhosphothreonineCombined sources1
Modified residuei1701PhosphoserineCombined sources1
Modified residuei1704PhosphoserineCombined sources1
Modified residuei1912PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7RTP6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q7RTP6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q7RTP6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q7RTP6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7RTP6

PeptideAtlas

More...
PeptideAtlasi
Q7RTP6

PRoteomics IDEntifications database

More...
PRIDEi
Q7RTP6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
68879 [Q7RTP6-1]
68880 [Q7RTP6-2]
68881 [Q7RTP6-3]
68882 [Q7RTP6-4]
68883 [Q7RTP6-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7RTP6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7RTP6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000243156 Expressed in 149 organ(s), highest expression level in cerebellum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7RTP6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7RTP6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA000639
HPA003421
HPA034882

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RAB1B, RAB8A, RAB10, RAB13 and RAB15 (in their GTP-bound forms); binding to RAB1B is of low affinity compared to other Rab proteins; at least in case of RAB8A can bind 2 molecules of RAB8A simultaneously through a high and a low affinity binding site, respectively.

Interacts with ERC1 and RAB8A; may bridge ERC1 with RAB8A.

Interacts with KIF23 and ERC1; enhances the interaction between KIF23 and ERC1.

Interacts with NINL isoform 2.

5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q022418EBI-13945605,EBI-306852

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121609, 35 interactors

Protein interaction database and analysis system

More...
IntActi
Q7RTP6, 44 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000416015

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

12002
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7RTP6

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q7RTP6

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini518 – 624Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST107
Domaini762 – 824LIM zinc-bindingPROSITE-ProRule annotationAdd BLAST63
Domaini1841 – 1990bMERBPROSITE-ProRule annotationAdd BLAST150

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni2 – 494Monooxygenase domainBy similarityAdd BLAST493

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1821 – 1992Sequence analysisAdd BLAST172

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi663 – 684Nuclear localization signal1 PublicationAdd BLAST22

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi688 – 691Poly-Glu4
Compositional biasi889 – 1138Glu-richAdd BLAST250
Compositional biasi1141 – 1505Pro-richAdd BLAST365

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The bivalent Mical/EHBP Rab binding (bMERB) domain, mediates binding to predominantly Rab8, Rab10, Rab10, Rab13 and Rab15 (in their GTP-bound forms).1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Mical family.Curated

Keywords - Domaini

Coiled coil, LIM domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1700 Eukaryota
COG5069 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155580

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000047263

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7RTP6

KEGG Orthology (KO)

More...
KOi
K19947

Identification of Orthologs from Complete Genome Data

More...
OMAi
ESERIGW

Database of Orthologous Groups

More...
OrthoDBi
430978at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7RTP6

TreeFam database of animal gene trees

More...
TreeFami
TF324129

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00014 CH, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.418.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022735 bMERB_dom
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR002938 FAD-bd
IPR036188 FAD/NAD-bd_sf
IPR029941 MICAL3
IPR001781 Znf_LIM

The PANTHER Classification System

More...
PANTHERi
PTHR23167:SF51 PTHR23167:SF51, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00307 CH, 1 hit
PF12130 DUF3585, 1 hit
PF01494 FAD_binding_3, 1 hit
PF00412 LIM, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00033 CH, 1 hit
SM00132 LIM, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47576 SSF47576, 1 hit
SSF51905 SSF51905, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51848 BMERB, 1 hit
PS50021 CH, 1 hit
PS00478 LIM_DOMAIN_1, 1 hit
PS50023 LIM_DOMAIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 5 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7RTP6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEERKHETMN PAHVLFDRFV QATTCKGTLK AFQELCDHLE LKPKDYRSFY
60 70 80 90 100
HKLKSKLNYW KAKALWAKLD KRGSHKDYKK GKACTNTKCL IIGAGPCGLR
110 120 130 140 150
TAIDLSLLGA KVVVIEKRDA FSRNNVLHLW PFTIHDLRGL GAKKFYGKFC
160 170 180 190 200
AGAIDHISIR QLQLILLKVA LILGIEIHVN VEFQGLIQPP EDQENERIGW
210 220 230 240 250
RALVHPKTHP VSEYEFEVII GGDGRRNTLE GFRRKEFRGK LAIAITANFI
260 270 280 290 300
NRNTTAEAKV EEISGVAFIF NQKFFQELRE ATGIDLENIV YYKDDTHYFV
310 320 330 340 350
MTAKKQSLLD KGVILHDYAD TELLLSRENV DQEALLSYAR EAADFSTQQQ
360 370 380 390 400
LPSLDFAINH YGQPDVAMFD FTCMYASENA ALVREQNGHQ LLVALVGDSL
410 420 430 440 450
LEPFWPMGTG IARGFLAAMD SAWMVRSWSL GTSPLEVLAE RESIYRLLPQ
460 470 480 490 500
TTPENVSKNF SQYSIDPVTR YPNINVNFLR PSQVRHLYDT GETKDIHLEM
510 520 530 540 550
ESLVNSRTTP KLTRNESVAR SSKLLGWCQR QTDGYAGVNV TDLTMSWKSG
560 570 580 590 600
LALCAIIHRY RPDLIDFDSL DEQNVEKNNQ LAFDIAEKEL GISPIMTGKE
610 620 630 640 650
MASVGEPDKL SMVMYLTQFY EMFKDSLPSS DTLDLNAEEK AVLIASTRSP
660 670 680 690 700
ISFLSKLGQT ISRKRSPKDK KEKDLDGAGK RRKTSQSEEE EAPRGHRGER
710 720 730 740 750
PTLVSTLTDR RMDVAVGNQN KVKYMATQLL AKFEENAPAQ SIGIRRQGSM
760 770 780 790 800
KKEFPQNLGG SDTCYFCQKR VYVMERLSAE GKFFHRSCFK CEYCATTLRL
810 820 830 840 850
SAYAYDIEDG KFYCKPHYCY RLSGYAQRKR PAVAPLSGKE AKGPLQDGAT
860 870 880 890 900
TDANGRANAV ASSTERTPGS GVNGLEEPSI AKRLRGTPER IELENYRLSL
910 920 930 940 950
RQAEALQEVP EETQAEHNLS SVLDTGAEED VASSSSESEM EEEGEEEEEE
960 970 980 990 1000
PRLPPSDLGG VPWKEAVRIH ALLKGKSEEE LEASKSFGPG NEEEEEEEEE
1010 1020 1030 1040 1050
YEEEEEEDYD EEEEESSEAG NQRLQQVMHA ADPLEIQADV HWTHIREREE
1060 1070 1080 1090 1100
EERMAPASES SASGAPLDEN DLEEDVDSEP AEIEGEAAED GDPGDTGAEL
1110 1120 1130 1140 1150
DDDQHWSDSP SDADRELRLP CPAEGEAELE LRVSEDEEKL PASPKHQERG
1160 1170 1180 1190 1200
PSQATSPIRS PQESALLFIP VHSPSTEGPQ LPPVPAATQE KSPEERLFPE
1210 1220 1230 1240 1250
PLLPKEKPKA DAPSDLKAVH SPIRSQPVTL PEARTPVSPG SPQPQPPVAA
1260 1270 1280 1290 1300
STPPPSPLPI CSQPQPSTEA TVPSPTQSPI RFQPAPAKTS TPLAPLPVQS
1310 1320 1330 1340 1350
QSDTKDRLGS PLAVDEALRR SDLVEEFWMK SAEIRRSLGL TPVDRSKGPE
1360 1370 1380 1390 1400
PSFPTPAFRP VSLKSYSVEK SPQDEGLHLL KPLSIPKRLG LPKPEGEPLS
1410 1420 1430 1440 1450
LPTPRSPSDR ELRSAQEERR ELSSSSGLGL HGSSSNMKTL GSQSFNTSDS
1460 1470 1480 1490 1500
AMLTPPSSPP PPPPPGEEPA TLRRKLREAE PNASVVPPPL PATWMRPPRE
1510 1520 1530 1540 1550
PAQPPREEVR KSFVESVEEI PFADDVEDTY DDKTEDSSLQ EKFFTPPSCW
1560 1570 1580 1590 1600
PRPEKPRHPP LAKENGRLPA LEGTLQPQKR GLPLVSAEAK ELAEERMRAR
1610 1620 1630 1640 1650
EKSVKSQALR DAMARQLSRM QQMELASGAP RPRKASSAPS QGKERRPDSP
1660 1670 1680 1690 1700
TRPTLRGSEE PTLKHEATSE EVLSPPSDSG GPDGSFTSSE GSSGKSKKRS
1710 1720 1730 1740 1750
SLFSPRRNKK EKKSKGEGRP PEKPSSNLLE EAAAKPKSLW KSVFSGYKKD
1760 1770 1780 1790 1800
KKKKADDKSC PSTPSSGATV DSGKHRVLPV VRAELQLRRQ LSFSEDSDLS
1810 1820 1830 1840 1850
SDDVLEKSSQ KSRREPRTYT EEELNAKLTR RVQKAARRQA KQEELKRLHR
1860 1870 1880 1890 1900
AQIIQRQLQQ VEERQRRLEE RGVAVEKALR GEAGMGKKDD PKLMQEWFKL
1910 1920 1930 1940 1950
VQEKNAMVRY ESELMIFARE LELEDRQSRL QQELRERMAV EDHLKTEEEL
1960 1970 1980 1990 2000
SEEKQILNEM LEVVEQRDSL VALLEEQRLR EREEDKDLEA AMLSKGFSLN

WS
Length:2,002
Mass (Da):224,295
Last modified:July 13, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF85C97FD4D647B80
GO
Isoform 2 (identifier: Q7RTP6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     934-948: SSSESEMEEEGEEEE → RSARRAAGRPPATRP
     949-2002: Missing.

Note: No experimental confirmation available.
Show »
Length:948
Mass (Da):106,837
Checksum:iD50FC4EC6F46D30C
GO
Isoform 3 (identifier: Q7RTP6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     746-746: R → RQLTQERGASQPSCCLPGQVRPAPTPRWK
     934-948: SSSESEMEEEGEEEE → RSARRAAGRPPATRP
     949-2002: Missing.

Show »
Length:976
Mass (Da):109,911
Checksum:iD94482577189AD04
GO
Isoform 4 (identifier: Q7RTP6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     934-966: SSSESEMEEEGEEEEEEPRLPPSDLGGVPWKEA → RDWVSPWLPRMVSNSWAQMIHPPQPPTVLGSQM
     967-2002: Missing.

Show »
Length:966
Mass (Da):109,047
Checksum:iDC1B9C83CB4D3E35
GO
Isoform 5 (identifier: Q7RTP6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     747-747: Q → QQREKECSRT...PKALLDKKEL
     871-949: GVNGLEEPSI...MEEEGEEEEE → LTSLFGWVAR...GEFHWQAVAQ
     950-2002: Missing.

Note: No experimental confirmation available.
Show »
Length:1,073
Mass (Da):121,173
Checksum:iC550AC7BE7536179
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KRP8J3KRP8_HUMAN
[F-actin]-monooxygenase MICAL3
MICAL3
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSK6J3KSK6_HUMAN
[F-actin]-monooxygenase MICAL3
MICAL3
496Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KTB6J3KTB6_HUMAN
[F-actin]-monooxygenase MICAL3
MICAL3
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QQT0J3QQT0_HUMAN
[F-actin]-monooxygenase MICAL3
MICAL3
269Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J922C9J922_HUMAN
[F-actin]-monooxygenase MICAL3
MICAL3
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PP85E9PP85_HUMAN
[F-actin]-monooxygenase MICAL3
MICAL3
335Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLA3J3QLA3_HUMAN
[F-actin]-monooxygenase MICAL3
MICAL3
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QR21J3QR21_HUMAN
[F-actin]-monooxygenase MICAL3
MICAL3
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti414G → D in BX647382 (PubMed:17974005).Curated1
Sequence conflicti1245Q → R in BAA74842 (PubMed:10718198).Curated1
Sequence conflicti1717E → V in AAH06562 (PubMed:15489334).Curated1
Isoform 4 (identifier: Q7RTP6-4)
Sequence conflicti957Q → R in BX647382 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05945111P → A. Corresponds to variant dbSNP:rs11913706Ensembl.1
Natural variantiVAR_059452745R → Q. Corresponds to variant dbSNP:rs2289719Ensembl.1
Natural variantiVAR_018263750M → L. Corresponds to variant dbSNP:rs5992128Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_039485746R → RQLTQERGASQPSCCLPGQV RPAPTPRWK in isoform 3. 1 Publication1
Alternative sequenceiVSP_042600747Q → QQREKECSRTCPKKVITLSP PPTPPPCRAHGGQQTYRDLD ADNRGKQSPHHERPEPEPPR RFFVDQWELSLSLRSSARPA SPSSDSLRQKYIKMYTGGVS SLAEQIANQLQRKEQPKALL DKKEL in isoform 5. 1 Publication1
Alternative sequenceiVSP_042601871 – 949GVNGL…EEEEE → LTSLFGWVARHSLGLCDKAK GMSQHLQSNISSFGQQVAQN PLDSFFMCQLLAFGVPFLYG LSEVLVQIRGEFHWQAVAQ in isoform 5. 1 PublicationAdd BLAST79
Alternative sequenceiVSP_039486934 – 966SSSES…PWKEA → RDWVSPWLPRMVSNSWAQMI HPPQPPTVLGSQM in isoform 4. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_039487934 – 948SSSES…GEEEE → RSARRAAGRPPATRP in isoform 2 and isoform 3. 2 PublicationsAdd BLAST15
Alternative sequenceiVSP_039488949 – 2002Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST1054
Alternative sequenceiVSP_042602950 – 2002Missing in isoform 5. 1 PublicationAdd BLAST1053
Alternative sequenceiVSP_039489967 – 2002Missing in isoform 4. 2 PublicationsAdd BLAST1036

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
CR456364 mRNA Translation: CAG30250.1
BX647382 mRNA No translation available.
AC016026 Genomic DNA No translation available.
AC016027 Genomic DNA No translation available.
BC006562 mRNA Translation: AAH06562.2
BC085009 mRNA Translation: AAH85009.1
BC157876 mRNA Translation: AAI57877.1
BC171887 mRNA Translation: AAI71887.1
AB020626 mRNA Translation: BAA74842.1
AB037785 mRNA Translation: BAA92602.1
BK000464 mRNA Translation: DAA01343.1
BK000465 mRNA Translation: DAA01344.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46659.1 [Q7RTP6-1]
CCDS46660.1 [Q7RTP6-4]
CCDS46661.1 [Q7RTP6-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001116203.1, NM_001122731.2 [Q7RTP6-4]
NP_001129476.1, NM_001136004.3 [Q7RTP6-5]
NP_056056.2, NM_015241.2 [Q7RTP6-1]
XP_005261319.1, XM_005261262.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000383094; ENSP00000372574; ENSG00000243156 [Q7RTP6-2]
ENST00000400561; ENSP00000383406; ENSG00000243156 [Q7RTP6-4]
ENST00000414725; ENSP00000391827; ENSG00000243156 [Q7RTP6-3]
ENST00000441493; ENSP00000416015; ENSG00000243156 [Q7RTP6-1]
ENST00000585038; ENSP00000462033; ENSG00000243156 [Q7RTP6-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57553

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57553

UCSC genome browser

More...
UCSCi
uc002zng.5 human [Q7RTP6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CR456364 mRNA Translation: CAG30250.1
BX647382 mRNA No translation available.
AC016026 Genomic DNA No translation available.
AC016027 Genomic DNA No translation available.
BC006562 mRNA Translation: AAH06562.2
BC085009 mRNA Translation: AAH85009.1
BC157876 mRNA Translation: AAI57877.1
BC171887 mRNA Translation: AAI71887.1
AB020626 mRNA Translation: BAA74842.1
AB037785 mRNA Translation: BAA92602.1
BK000464 mRNA Translation: DAA01343.1
BK000465 mRNA Translation: DAA01344.1
CCDSiCCDS46659.1 [Q7RTP6-1]
CCDS46660.1 [Q7RTP6-4]
CCDS46661.1 [Q7RTP6-5]
RefSeqiNP_001116203.1, NM_001122731.2 [Q7RTP6-4]
NP_001129476.1, NM_001136004.3 [Q7RTP6-5]
NP_056056.2, NM_015241.2 [Q7RTP6-1]
XP_005261319.1, XM_005261262.3

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D88NMR-A518-625[»]
5SZGX-ray2.70A/B1841-1990[»]
SMRiQ7RTP6
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi121609, 35 interactors
IntActiQ7RTP6, 44 interactors
STRINGi9606.ENSP00000416015

PTM databases

iPTMnetiQ7RTP6
PhosphoSitePlusiQ7RTP6

Polymorphism and mutation databases

BioMutaiMICAL3
DMDMi300669653

Proteomic databases

EPDiQ7RTP6
jPOSTiQ7RTP6
MassIVEiQ7RTP6
MaxQBiQ7RTP6
PaxDbiQ7RTP6
PeptideAtlasiQ7RTP6
PRIDEiQ7RTP6
ProteomicsDBi68879 [Q7RTP6-1]
68880 [Q7RTP6-2]
68881 [Q7RTP6-3]
68882 [Q7RTP6-4]
68883 [Q7RTP6-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
57553

Genome annotation databases

EnsembliENST00000383094; ENSP00000372574; ENSG00000243156 [Q7RTP6-2]
ENST00000400561; ENSP00000383406; ENSG00000243156 [Q7RTP6-4]
ENST00000414725; ENSP00000391827; ENSG00000243156 [Q7RTP6-3]
ENST00000441493; ENSP00000416015; ENSG00000243156 [Q7RTP6-1]
ENST00000585038; ENSP00000462033; ENSG00000243156 [Q7RTP6-5]
GeneIDi57553
KEGGihsa:57553
UCSCiuc002zng.5 human [Q7RTP6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57553
DisGeNETi57553

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MICAL3
HGNCiHGNC:24694 MICAL3
HPAiHPA000639
HPA003421
HPA034882
MIMi608882 gene
neXtProtiNX_Q7RTP6
OpenTargetsiENSG00000243156
PharmGKBiPA142671454

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1700 Eukaryota
COG5069 LUCA
GeneTreeiENSGT00940000155580
HOGENOMiHOG000047263
InParanoidiQ7RTP6
KOiK19947
OMAiESERIGW
OrthoDBi430978at2759
PhylomeDBiQ7RTP6
TreeFamiTF324129

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MICAL3 human
EvolutionaryTraceiQ7RTP6

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MICAL3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57553
PharosiQ7RTP6

Protein Ontology

More...
PROi
PR:Q7RTP6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000243156 Expressed in 149 organ(s), highest expression level in cerebellum
ExpressionAtlasiQ7RTP6 baseline and differential
GenevisibleiQ7RTP6 HS

Family and domain databases

CDDicd00014 CH, 1 hit
Gene3Di1.10.418.10, 1 hit
InterProiView protein in InterPro
IPR022735 bMERB_dom
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR002938 FAD-bd
IPR036188 FAD/NAD-bd_sf
IPR029941 MICAL3
IPR001781 Znf_LIM
PANTHERiPTHR23167:SF51 PTHR23167:SF51, 1 hit
PfamiView protein in Pfam
PF00307 CH, 1 hit
PF12130 DUF3585, 1 hit
PF01494 FAD_binding_3, 1 hit
PF00412 LIM, 1 hit
SMARTiView protein in SMART
SM00033 CH, 1 hit
SM00132 LIM, 1 hit
SUPFAMiSSF47576 SSF47576, 1 hit
SSF51905 SSF51905, 1 hit
PROSITEiView protein in PROSITE
PS51848 BMERB, 1 hit
PS50021 CH, 1 hit
PS00478 LIM_DOMAIN_1, 1 hit
PS50023 LIM_DOMAIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMICA3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7RTP6
Secondary accession number(s): B2RXJ5
, E9PEF0, O94909, Q5U4P4, Q6ICK4, Q96DF2, Q9P2I3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: July 13, 2010
Last modified: November 13, 2019
This is version 169 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again