Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (16 Oct 2019)
Sequence version 1 (15 Dec 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

STE20-related kinase adapter protein alpha

Gene

STRADA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Pseudokinase which, in complex with CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta), binds to and activates STK11/LKB1. Adopts a closed conformation typical of active protein kinases and binds STK11/LKB1 as a pseudosubstrate, promoting conformational change of STK11/LKB1 in an active conformation.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-380972 Energy dependent regulation of mTOR by LKB1-AMPK

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q7RTN6

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q7RTN6

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
STE20-related kinase adapter protein alpha
Short name:
STRAD alpha
Alternative name(s):
STE20-related adapter protein
Serologically defined breast cancer antigen NY-BR-96
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:STRADA
Synonyms:LYK5Imported, STRAD
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30172 STRADA

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608626 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7RTN6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A homozygous 7-kb deletion involving STRADA is a cause of a syndrome characterized by polyhydramnios, megalencephaly and symptomatic epilepsy.

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi185Y → F: Suppresses STK11/LKB1 activation without affecting complex assembly. 1 Publication1
Mutagenesisi231H → A: Inhibits interaction with STK11/LKB1; when associated with A-. 1 Publication1
Mutagenesisi233F → A: Inhibits interaction with STK11/LKB1; when associated with A-. 1 Publication1
Mutagenesisi241L → A: Inhibits interaction with STK11/LKB1. 1 Publication1
Mutagenesisi251Q → A: Inhibits interaction with STK11/LKB1. 1 Publication1
Mutagenesisi329T → A: Loss of STK11/LKB1-mediated phosphorylation. 1 Publication1
Mutagenesisi419T → A: Loss of STK11/LKB1-mediated phosphorylation. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
92335

MalaCards human disease database

More...
MalaCardsi
STRADA
MIMi611087 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000266173

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
500533 Polyhydramnios-megalencephaly-symptomatic epilepsy syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164726342

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q7RTN6

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1795198

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
STRADA

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74759034

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002600351 – 431STE20-related kinase adapter protein alphaAdd BLAST431

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2PhosphoserineCombined sources1
Modified residuei46PhosphoserineCombined sources1
Modified residuei329Phosphothreonine; by LKB11 Publication1
Modified residuei419Phosphothreonine; by LKB11 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7RTN6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q7RTN6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q7RTN6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q7RTN6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7RTN6

PeptideAtlas

More...
PeptideAtlasi
Q7RTN6

PRoteomics IDEntifications database

More...
PRIDEi
Q7RTN6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
63016
68873 [Q7RTN6-1]
68874 [Q7RTN6-2]
68875 [Q7RTN6-3]
68876 [Q7RTN6-4]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q7RTN6-4 [Q7RTN6-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7RTN6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7RTN6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000266173 Expressed in 100 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7RTN6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7RTN6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA031637

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of a trimeric complex composed of STK11/LKB1, STRAD (STRADA or STRADB) and CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta): the complex tethers STK11/LKB1 in the cytoplasm and stimulates its catalytic activity.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124934, 10 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q7RTN6

Database of interacting proteins

More...
DIPi
DIP-35775N

Protein interaction database and analysis system

More...
IntActi
Q7RTN6, 7 interactors

Molecular INTeraction database

More...
MINTi
Q7RTN6

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000336655

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1431
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7RTN6

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q7RTN6

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini69 – 379Protein kinasePROSITE-ProRule annotationAdd BLAST311

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The protein kinase domain is predicted to be catalytically inactive.Sequence analysis

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0582 Eukaryota
ENOG410XSWS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158827

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000237355

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7RTN6

KEGG Orthology (KO)

More...
KOi
K08271

Identification of Orthologs from Complete Genome Data

More...
OMAi
NHGQRLK

Database of Orthologous Groups

More...
OrthoDBi
995563at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7RTN6

TreeFam database of animal gene trees

More...
TreeFami
TF319817

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00069 Pkinase, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 30 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q7RTN6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSFLVSKPER IRRWVSEKFI VEGLRDLELF GEQPPGDTRR KTNDASSESI
60 70 80 90 100
ASFSKQEVMS SFLPEGGCYE LLTVIGKGFE DLMTVNLARY KPTGEYVTVR
110 120 130 140 150
RINLEACSNE MVTFLQGELH VSKLFNHPNI VPYRATFIAD NELWVVTSFM
160 170 180 190 200
AYGSAKDLIC THFMDGMNEL AIAYILQGVL KALDYIHHMG YVHRSVKASH
210 220 230 240 250
ILISVDGKVY LSGLRSNLSM ISHGQRQRVV HDFPKYSVKV LPWLSPEVLQ
260 270 280 290 300
QNLQGYDAKS DIYSVGITAC ELANGHVPFK DMPATQMLLE KLNGTVPCLL
310 320 330 340 350
DTSTIPAEEL TMSPSRSVAN SGLSDSLTTS TPRPSNGDSP SHPYHRTFSP
360 370 380 390 400
HFHHFVEQCL QRNPDARPSA STLLNHSFFK QIKRRASEAL PELLRPVTPI
410 420 430
TNFEGSQSQD HSGIFGLVTN LEELEVDDWE F
Length:431
Mass (Da):48,369
Last modified:December 15, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9CC0A78D9CC6FC2C
GO
Isoform 22 Publications (identifier: Q7RTN6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-41: Missing.
     368-417: PSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGL → YPCWPGPGLRESRGCSGG
     418-431: Missing.

Show »
Length:348
Mass (Da):38,597
Checksum:iB4A9F1EDE0E86EF4
GO
Isoform 31 Publication (identifier: Q7RTN6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-41: Missing.

Show »
Length:394
Mass (Da):43,962
Checksum:i35C80CA906403ADC
GO
Isoform 4 (identifier: Q7RTN6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     32-75: Missing.
     338-431: DSPSHPYHRT...EELEVDDWEF → PVPAPS

Note: No experimental confirmation available.
Show »
Length:299
Mass (Da):33,277
Checksum:i164D23B3189837FC
GO
Isoform 5 (identifier: Q7RTN6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-58: Missing.

Show »
Length:373
Mass (Da):41,701
Checksum:i3E2837347D7BC42C
GO
Isoform 6 (identifier: Q7RTN6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     13-41: Missing.
     338-431: DSPSHPYHRT...EELEVDDWEF → PVPAPS

Note: No experimental confirmation available.
Show »
Length:314
Mass (Da):34,625
Checksum:i12F519738B45CDF6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 30 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1W2PQF1A0A1W2PQF1_HUMAN
STE20-related kinase adapter protei...
STRADA
403Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PPG2A0A1W2PPG2_HUMAN
STE20-related kinase adapter protei...
STRADA
343Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PPJ9A0A1W2PPJ9_HUMAN
STE20-related kinase adapter protei...
STRADA
402Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PQE8A0A1W2PQE8_HUMAN
STE20-related kinase adapter protei...
STRADA
285Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PR00A0A1W2PR00_HUMAN
STE20-related kinase adapter protei...
STRADA
306Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PPM8A0A1W2PPM8_HUMAN
STE20-related kinase adapter protei...
STRADA
345Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PP78A0A1W2PP78_HUMAN
STE20-related kinase adapter protei...
STRADA
325Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q86YC8Q86YC8_HUMAN
STE20-related kinase adapter protei...
STRADA
234Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRH3J3QRH3_HUMAN
STE20-related kinase adapter protei...
STRADA
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QQS3J3QQS3_HUMAN
STE20-related kinase adapter protei...
STRADA
234Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti163F → S in BAG62879 (PubMed:14702039).Curated1
Sequence conflicti339S → W in AAG48269 (PubMed:12747765).Curated1
Sequence conflicti363N → H in BAC11349 (PubMed:14702039).Curated1
Sequence conflicti388E → K in AAG48269 (PubMed:12747765).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04137713R → W1 PublicationCorresponds to variant dbSNP:rs35808156EnsemblClinVar.1
Natural variantiVAR_04137860S → I1 PublicationCorresponds to variant dbSNP:rs56271007EnsemblClinVar.1
Natural variantiVAR_04137964P → S1 PublicationCorresponds to variant dbSNP:rs55695051EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0442781 – 58Missing in isoform 5. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_0522195 – 41Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST37
Alternative sequenceiVSP_04471713 – 41Missing in isoform 6. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_04370732 – 75Missing in isoform 4. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_043708338 – 431DSPSH…DDWEF → PVPAPS in isoform 4 and isoform 6. 1 PublicationAdd BLAST94
Alternative sequenceiVSP_052220368 – 417PSAST…GIFGL → YPCWPGPGLRESRGCSGG in isoform 2. 2 PublicationsAdd BLAST50
Alternative sequenceiVSP_052221418 – 431Missing in isoform 2. 2 PublicationsAdd BLAST14

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF308302 mRNA Translation: AAG48269.1
AY290821 mRNA Translation: AAP42280.1
AK074771 mRNA Translation: BAC11197.1
AK075005 mRNA Translation: BAC11349.1
AK293160 mRNA Translation: BAG56704.1
AK301331 mRNA Translation: BAG62879.1
AL832407 mRNA Translation: CAI46194.1
AC015651 Genomic DNA No translation available.
AC046185 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94283.1
BK001542 mRNA Translation: DAA01797.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11642.1 [Q7RTN6-2]
CCDS32703.1 [Q7RTN6-1]
CCDS42367.1 [Q7RTN6-5]
CCDS54156.1 [Q7RTN6-4]
CCDS58585.1 [Q7RTN6-6]
CCDS86632.1 [Q7RTN6-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001003786.1, NM_001003786.2 [Q7RTN6-3]
NP_001003787.1, NM_001003787.2 [Q7RTN6-1]
NP_001003788.1, NM_001003788.2 [Q7RTN6-5]
NP_001159441.1, NM_001165969.1 [Q7RTN6-6]
NP_001159442.1, NM_001165970.1 [Q7RTN6-4]
NP_699166.2, NM_153335.5 [Q7RTN6-2]
XP_005257856.1, XM_005257799.2 [Q7RTN6-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000336174; ENSP00000336655; ENSG00000266173 [Q7RTN6-1]
ENST00000375840; ENSP00000365000; ENSG00000266173 [Q7RTN6-5]
ENST00000392950; ENSP00000376677; ENSG00000266173 [Q7RTN6-2]
ENST00000447001; ENSP00000398841; ENSG00000266173 [Q7RTN6-4]
ENST00000582137; ENSP00000462922; ENSG00000266173 [Q7RTN6-6]
ENST00000638702; ENSP00000491017; ENSG00000266173 [Q7RTN6-5]
ENST00000639835; ENSP00000492578; ENSG00000266173 [Q7RTN6-3]
ENST00000640999; ENSP00000491643; ENSG00000266173 [Q7RTN6-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
92335

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:92335

UCSC genome browser

More...
UCSCi
uc002jbm.4 human [Q7RTN6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF308302 mRNA Translation: AAG48269.1
AY290821 mRNA Translation: AAP42280.1
AK074771 mRNA Translation: BAC11197.1
AK075005 mRNA Translation: BAC11349.1
AK293160 mRNA Translation: BAG56704.1
AK301331 mRNA Translation: BAG62879.1
AL832407 mRNA Translation: CAI46194.1
AC015651 Genomic DNA No translation available.
AC046185 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94283.1
BK001542 mRNA Translation: DAA01797.1
CCDSiCCDS11642.1 [Q7RTN6-2]
CCDS32703.1 [Q7RTN6-1]
CCDS42367.1 [Q7RTN6-5]
CCDS54156.1 [Q7RTN6-4]
CCDS58585.1 [Q7RTN6-6]
CCDS86632.1 [Q7RTN6-3]
RefSeqiNP_001003786.1, NM_001003786.2 [Q7RTN6-3]
NP_001003787.1, NM_001003787.2 [Q7RTN6-1]
NP_001003788.1, NM_001003788.2 [Q7RTN6-5]
NP_001159441.1, NM_001165969.1 [Q7RTN6-6]
NP_001159442.1, NM_001165970.1 [Q7RTN6-4]
NP_699166.2, NM_153335.5 [Q7RTN6-2]
XP_005257856.1, XM_005257799.2 [Q7RTN6-5]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1UPKX-ray1.85B420-431[»]
2WTKX-ray2.65B/E59-431[»]
3GNIX-ray2.35B59-431[»]
SMRiQ7RTN6
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi124934, 10 interactors
CORUMiQ7RTN6
DIPiDIP-35775N
IntActiQ7RTN6, 7 interactors
MINTiQ7RTN6
STRINGi9606.ENSP00000336655

Chemistry databases

ChEMBLiCHEMBL1795198

PTM databases

iPTMnetiQ7RTN6
PhosphoSitePlusiQ7RTN6

Polymorphism and mutation databases

BioMutaiSTRADA
DMDMi74759034

Proteomic databases

EPDiQ7RTN6
jPOSTiQ7RTN6
MassIVEiQ7RTN6
MaxQBiQ7RTN6
PaxDbiQ7RTN6
PeptideAtlasiQ7RTN6
PRIDEiQ7RTN6
ProteomicsDBi63016
68873 [Q7RTN6-1]
68874 [Q7RTN6-2]
68875 [Q7RTN6-3]
68876 [Q7RTN6-4]
TopDownProteomicsiQ7RTN6-4 [Q7RTN6-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
92335

Genome annotation databases

EnsembliENST00000336174; ENSP00000336655; ENSG00000266173 [Q7RTN6-1]
ENST00000375840; ENSP00000365000; ENSG00000266173 [Q7RTN6-5]
ENST00000392950; ENSP00000376677; ENSG00000266173 [Q7RTN6-2]
ENST00000447001; ENSP00000398841; ENSG00000266173 [Q7RTN6-4]
ENST00000582137; ENSP00000462922; ENSG00000266173 [Q7RTN6-6]
ENST00000638702; ENSP00000491017; ENSG00000266173 [Q7RTN6-5]
ENST00000639835; ENSP00000492578; ENSG00000266173 [Q7RTN6-3]
ENST00000640999; ENSP00000491643; ENSG00000266173 [Q7RTN6-3]
GeneIDi92335
KEGGihsa:92335
UCSCiuc002jbm.4 human [Q7RTN6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
92335
DisGeNETi92335

GeneCards: human genes, protein and diseases

More...
GeneCardsi
STRADA
HGNCiHGNC:30172 STRADA
HPAiHPA031637
MalaCardsiSTRADA
MIMi608626 gene
611087 phenotype
neXtProtiNX_Q7RTN6
OpenTargetsiENSG00000266173
Orphaneti500533 Polyhydramnios-megalencephaly-symptomatic epilepsy syndrome
PharmGKBiPA164726342

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0582 Eukaryota
ENOG410XSWS LUCA
GeneTreeiENSGT00940000158827
HOGENOMiHOG000237355
InParanoidiQ7RTN6
KOiK08271
OMAiNHGQRLK
OrthoDBi995563at2759
PhylomeDBiQ7RTN6
TreeFamiTF319817

Enzyme and pathway databases

ReactomeiR-HSA-380972 Energy dependent regulation of mTOR by LKB1-AMPK
SignaLinkiQ7RTN6
SIGNORiQ7RTN6

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
STRADA human
EvolutionaryTraceiQ7RTN6

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LYK5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
92335
PharosiQ7RTN6

Protein Ontology

More...
PROi
PR:Q7RTN6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000266173 Expressed in 100 organ(s), highest expression level in testis
ExpressionAtlasiQ7RTN6 baseline and differential
GenevisibleiQ7RTN6 HS

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTRAA_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7RTN6
Secondary accession number(s): B4DDE3
, B4DW17, J3KTC9, Q5JPI2, Q7Z4K9, Q8NC31, Q8NCF1, Q9H272
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: December 15, 2003
Last modified: October 16, 2019
This is version 151 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  7. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again