Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 148 (02 Jun 2021)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Heparan sulfate 2-O-sulfotransferase 1

Gene

HS2ST1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the transfer of sulfate to the C2-position of selected hexuronic acid residues within the maturing heparan sulfate (HS). 2-O-sulfation within HS, particularly of iduronate residues, is essential for HS to participate in a variety of high-affinity ligand-binding interactions and signaling processes. Mediates 2-O-sulfation of both L-iduronyl and D-glucuronyl residues (By similarity).

By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei140By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:ENSG00000153936-MONOMER

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q7LGA3

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2022928, HS-GAG biosynthesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Heparan sulfate 2-O-sulfotransferase 1 (EC:2.8.2.-)
Short name:
2-O-sulfotransferase
Short name:
2OST
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HS2ST1
Synonyms:HS2ST, KIAA0448
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:5193, HS2ST1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604844, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7LGA3

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000153936.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 11CytoplasmicSequence analysisAdd BLAST11
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei12 – 28Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST17
Topological domaini29 – 356LumenalSequence analysisAdd BLAST328

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9653

Open Targets

More...
OpenTargetsi
ENSG00000153936
ENSG00000267561

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29466

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q7LGA3, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HS2ST1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
68052326

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002076741 – 356Heparan sulfate 2-O-sulfotransferase 1Add BLAST356

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi108N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi127N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi201 ↔ 209By similarity
Disulfide bondi222 ↔ 228By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7LGA3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q7LGA3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q7LGA3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q7LGA3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7LGA3

PeptideAtlas

More...
PeptideAtlasi
Q7LGA3

PRoteomics IDEntifications database

More...
PRIDEi
Q7LGA3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
68865 [Q7LGA3-1]
68866 [Q7LGA3-2]
68867 [Q7LGA3-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1308, 3 N-Linked glycans (1 site)

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q7LGA3, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7LGA3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7LGA3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000153936, Expressed in adrenal tissue and 226 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7LGA3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7LGA3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000153936, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotrimer.

Interacts with the C5-epimerase GLCE (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
115011, 33 interactors

Protein interaction database and analysis system

More...
IntActi
Q7LGA3, 23 interactors

Molecular INTeraction database

More...
MINTi
Q7LGA3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000359581

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q7LGA3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7LGA3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the sulfotransferase 3 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3922, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063408

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_045310_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7LGA3

Identification of Orthologs from Complete Genome Data

More...
OMAi
QSNIWKI

Database of Orthologous Groups

More...
OrthoDBi
877221at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7LGA3

TreeFam database of animal gene trees

More...
TreeFami
TF315238

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007734, Heparan_SO4_2-O-STrfase
IPR027417, P-loop_NTPase
IPR005331, Sulfotransferase

The PANTHER Classification System

More...
PANTHERi
PTHR12129, PTHR12129, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03567, Sulfotransfer_2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540, SSF52540, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7LGA3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGLLRIMMPP KLQLLAVVAF AVAMLFLENQ IQKLEESRSK LERAIARHEV
60 70 80 90 100
REIEQRHTMD GPRQDATLDE EEDMVIIYNR VPKTASTSFT NIAYDLCAKN
110 120 130 140 150
KYHVLHINTT KNNPVMSLQD QVRFVKNITS WKEMKPGFYH GHVSYLDFAK
160 170 180 190 200
FGVKKKPIYI NVIRDPIERL VSYYYFLRFG DDYRPGLRRR KQGDKKTFDE
210 220 230 240 250
CVAEGGSDCA PEKLWLQIPF FCGHSSECWN VGSRWAMDQA KYNLINEYFL
260 270 280 290 300
VGVTEELEDF IMLLEAALPR FFRGATELYR TGKKSHLRKT TEKKLPTKQT
310 320 330 340 350
IAKLQQSDIW KMENEFYEFA LEQFQFIRAH AVREKDGDLY ILAQNFFYEK

IYPKSN
Length:356
Mass (Da):41,881
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2F5BBDFC7DF50F78
GO
Isoform 2 (identifier: Q7LGA3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKL → MLFIKFIHLEVFSMP
     282-356: GKKSHLRKTT...FYEKIYPKSN → APDTATPSHR...KCSRNGLSAV

Show »
Length:303
Mass (Da):34,907
Checksum:i33F937D451024A45
GO
Isoform 3 (identifier: Q7LGA3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-356: Missing.

Show »
Length:229
Mass (Da):26,757
Checksum:iF953C9470254BE9D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EP71K7EP71_HUMAN
Heparan sulfate 2-O-sulfotransferas...
HS2ST1
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA32293 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0140621 – 41MGLLR…SRSKL → MLFIKFIHLEVFSMP in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_014063230 – 356Missing in isoform 3. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_014064282 – 356GKKSH…YPKSN → APDTATPSHRHGPICGSKSI SSLLVKVSPVCKDSHCLGKC SRNGLSAV in isoform 2. 1 PublicationAdd BLAST75

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB024568 mRNA Translation: BAA89250.1
AB007917 mRNA Translation: BAA32293.2 Different initiation.
AK002179 mRNA Translation: BAA92125.1
AC093155 Genomic DNA No translation available.
AL121989 Genomic DNA No translation available.
AL139139 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW73171.1
CH471097 Genomic DNA Translation: EAW73172.1
BC025384 mRNA Translation: AAH25384.1
BC025990 mRNA Translation: AAH25990.1
BC108735 mRNA Translation: AAI08736.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44171.1 [Q7LGA3-3]
CCDS711.1 [Q7LGA3-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001127964.1, NM_001134492.1 [Q7LGA3-3]
NP_036394.1, NM_012262.3 [Q7LGA3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000370550; ENSP00000359581; ENSG00000153936 [Q7LGA3-1]
ENST00000370551; ENSP00000359582; ENSG00000153936 [Q7LGA3-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9653

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9653

UCSC genome browser

More...
UCSCi
uc001dmc.5, human [Q7LGA3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB024568 mRNA Translation: BAA89250.1
AB007917 mRNA Translation: BAA32293.2 Different initiation.
AK002179 mRNA Translation: BAA92125.1
AC093155 Genomic DNA No translation available.
AL121989 Genomic DNA No translation available.
AL139139 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW73171.1
CH471097 Genomic DNA Translation: EAW73172.1
BC025384 mRNA Translation: AAH25384.1
BC025990 mRNA Translation: AAH25990.1
BC108735 mRNA Translation: AAI08736.1
CCDSiCCDS44171.1 [Q7LGA3-3]
CCDS711.1 [Q7LGA3-1]
RefSeqiNP_001127964.1, NM_001134492.1 [Q7LGA3-3]
NP_036394.1, NM_012262.3 [Q7LGA3-1]

3D structure databases

SMRiQ7LGA3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi115011, 33 interactors
IntActiQ7LGA3, 23 interactors
MINTiQ7LGA3
STRINGi9606.ENSP00000359581

PTM databases

GlyConnecti1308, 3 N-Linked glycans (1 site)
GlyGeniQ7LGA3, 2 sites
iPTMnetiQ7LGA3
PhosphoSitePlusiQ7LGA3

Genetic variation databases

BioMutaiHS2ST1
DMDMi68052326

Proteomic databases

EPDiQ7LGA3
jPOSTiQ7LGA3
MassIVEiQ7LGA3
MaxQBiQ7LGA3
PaxDbiQ7LGA3
PeptideAtlasiQ7LGA3
PRIDEiQ7LGA3
ProteomicsDBi68865 [Q7LGA3-1]
68866 [Q7LGA3-2]
68867 [Q7LGA3-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
33591, 213 antibodies

The DNASU plasmid repository

More...
DNASUi
9653

Genome annotation databases

EnsembliENST00000370550; ENSP00000359581; ENSG00000153936 [Q7LGA3-1]
ENST00000370551; ENSP00000359582; ENSG00000153936 [Q7LGA3-3]
GeneIDi9653
KEGGihsa:9653
UCSCiuc001dmc.5, human [Q7LGA3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9653
DisGeNETi9653

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HS2ST1
HGNCiHGNC:5193, HS2ST1
HPAiENSG00000153936, Low tissue specificity
MIMi604844, gene
neXtProtiNX_Q7LGA3
OpenTargetsiENSG00000153936
ENSG00000267561
PharmGKBiPA29466
VEuPathDBiHostDB:ENSG00000153936.16

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3922, Eukaryota
GeneTreeiENSGT00530000063408
HOGENOMiCLU_045310_1_1_1
InParanoidiQ7LGA3
OMAiQSNIWKI
OrthoDBi877221at2759
PhylomeDBiQ7LGA3
TreeFamiTF315238

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000153936-MONOMER
PathwayCommonsiQ7LGA3
ReactomeiR-HSA-2022928, HS-GAG biosynthesis

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
9653, 18 hits in 1003 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HS2ST1, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
HS2ST1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9653
PharosiQ7LGA3, Tbio

Protein Ontology

More...
PROi
PR:Q7LGA3
RNActiQ7LGA3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000153936, Expressed in adrenal tissue and 226 other tissues
ExpressionAtlasiQ7LGA3, baseline and differential
GenevisibleiQ7LGA3, HS

Family and domain databases

InterProiView protein in InterPro
IPR007734, Heparan_SO4_2-O-STrfase
IPR027417, P-loop_NTPase
IPR005331, Sulfotransferase
PANTHERiPTHR12129, PTHR12129, 1 hit
PfamiView protein in Pfam
PF03567, Sulfotransfer_2, 1 hit
SUPFAMiSSF52540, SSF52540, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHS2ST_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7LGA3
Secondary accession number(s): D3DT22
, O75036, Q32NB5, Q8TAC5, Q9H441, Q9NUJ9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: July 5, 2004
Last modified: June 2, 2021
This is version 148 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again