Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RAS guanyl-releasing protein 2

Gene

RASGRP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. May also activates other GTPases such as RRAS, RRAS2, NRAS, KRAS but not HRAS. Functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils probably through inside-out integrin activation. May function in the muscarinic acetylcholine receptor M1/CHRM1 signaling pathway.6 Publications

Caution

Defects in RASGRP2 were initially thought (PubMed:17576779) to be the cause of leukocyte adhesion deficiency type 3 (LAD3), a syndrome characterized by recurrent bacterial infections and major bleeding disorders. However, it was later shown (PubMed:19064721, PubMed:19234463 and PubMed:19234460) that it is not the case and that LAD3 is caused by defects in FERMT3 gene.1 Publication

Activity regulationi

Isoform 1 and isoform 2 are differently regulated by calcium and DAG.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi439 – 4501PROSITE-ProRule annotation1 PublicationAdd BLAST12
Calcium bindingi468 – 4792PROSITE-ProRule annotation1 PublicationAdd BLAST12
Zinc fingeri498 – 548Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST51

GO - Molecular functioni

  • calcium ion binding Source: UniProtKB
  • diacylglycerol binding Source: UniProtKB
  • guanyl-nucleotide exchange factor activity Source: UniProtKB
  • lipid binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor
LigandCalcium, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-114508 Effects of PIP2 hydrolysis
R-HSA-2871837 FCERI mediated NF-kB activation
R-HSA-354192 Integrin alphaIIb beta3 signaling
R-HSA-392517 Rap1 signalling

Names & Taxonomyi

Protein namesi
Recommended name:
RAS guanyl-releasing protein 2
Alternative name(s):
Calcium and DAG-regulated guanine nucleotide exchange factor I
Short name:
CalDAG-GEFI
Cdc25-like protein
Short name:
hCDC25L
F25B3.3 kinase-like protein
Gene namesi
Name:RASGRP2
Synonyms:CDC25L, MCG7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000068831.18
HGNCiHGNC:9879 RASGRP2
MIMi605577 gene
neXtProtiNX_Q7LDG7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Synapse, Synaptosome

Pathology & Biotechi

Involvement in diseasei

Bleeding disorder, platelet-type 18 (BDPLT18)4 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by increased bleeding tendency due to platelet dysfunction. Clinical features include epistaxis, hematomas, bleeding after tooth extraction, and menorrhagia.
See also OMIM:615888
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_079614113 – 609Missing in BDPLT18. 1 PublicationAdd BLAST497
Natural variantiVAR_079615236 – 609Missing in BDPLT18; lack of mutant protein in platelets from a patient homozygous for the mutation. 1 PublicationAdd BLAST374
Natural variantiVAR_071474248G → W in BDPLT18; prevents Rap1 activation upon calcium stimulation; reduces platelet adhesion and spreading. 1 PublicationCorresponds to variant dbSNP:rs587777529EnsemblClinVar.1
Natural variantiVAR_079616296C → Y in BDPLT18; lack of mutant protein in platelets from a patient homozygous for the mutation. 1 Publication1
Natural variantiVAR_079617305G → D in BDPLT18. 1 Publication1
Natural variantiVAR_079618381S → F in BDPLT18; loss of guanyl-nucleotide exchange factor activity. 1 PublicationCorresponds to variant dbSNP:rs767965347Ensembl.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi10235
MalaCardsiRASGRP2
MIMi615888 phenotype
OpenTargetsiENSG00000068831
Orphaneti420566 Bleeding disorder due to CalDAG-GEFI deficiency
PharmGKBiPA34241

Polymorphism and mutation databases

BioMutaiRASGRP2
DMDMi74713056

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003156081 – 609RAS guanyl-releasing protein 2Add BLAST609
Isoform 2 (identifier: Q7LDG7-2)
Initiator methionineiRemoved1 Publication

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei116PhosphoserineBy similarity1
Modified residuei117PhosphoserineBy similarity1
Modified residuei147PhosphoserineBy similarity1
Modified residuei554PhosphoserineBy similarity1
Modified residuei576PhosphoserineBy similarity1
Isoform 2 (identifier: Q7LDG7-2)
Lipidationi2N-myristoyl glycine1 Publication1
Lipidationi7S-palmitoyl cysteine1 Publication1

Post-translational modificationi

Isoform 2 is palmitoylated and myristoylated.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ7LDG7
MaxQBiQ7LDG7
PaxDbiQ7LDG7
PeptideAtlasiQ7LDG7
PRIDEiQ7LDG7
ProteomicsDBi68852
68853 [Q7LDG7-2]
68854 [Q7LDG7-3]

PTM databases

iPTMnetiQ7LDG7
PhosphoSitePlusiQ7LDG7
SwissPalmiQ7LDG7

Expressioni

Tissue specificityi

Detected in platelets, neutrophils and T lymphocytes (at protein level). Expressed in brain where it is enriched in the striatum. Also expressed in the hematopoietic system. Detected in heart, brain, lung, placenta, liver, skeletal muscle and kidney.5 Publications

Developmental stagei

Expressed in fetal brain, lung, liver and kidney.1 Publication

Gene expression databases

BgeeiENSG00000068831 Expressed in 208 organ(s), highest expression level in blood
CleanExiHS_RASGRP2
ExpressionAtlasiQ7LDG7 baseline and differential
GenevisibleiQ7LDG7 HS

Organism-specific databases

HPAiHPA015667

Interactioni

Subunit structurei

Forms a signaling complex with RAP1 and BRAF (By similarity). Interacts with RAP1. Interacts with F-actin.By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115529, 2 interactors
IntActiQ7LDG7, 3 interactors
STRINGi9606.ENSP00000338864

Structurei

Secondary structure

1609
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ7LDG7
SMRiQ7LDG7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 126N-terminal Ras-GEFPROSITE-ProRule annotationAdd BLAST123
Domaini154 – 387Ras-GEFPROSITE-ProRule annotationAdd BLAST234
Domaini426 – 461EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini455 – 490EF-hand 2PROSITE-ProRule annotationAdd BLAST36

Domaini

The N-terminal Ras-GEF domain mediates association with F-actin.

Sequence similaritiesi

Belongs to the RASGRP family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri498 – 548Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST51

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG3417 Eukaryota
ENOG410XR96 LUCA
GeneTreeiENSGT00880000137870
HOGENOMiHOG000293171
HOVERGENiHBG007513
InParanoidiQ7LDG7
KOiK12361
OMAiMISYFLR
OrthoDBiEOG091G03RN
PhylomeDBiQ7LDG7
TreeFamiTF312918

Family and domain databases

CDDicd00029 C1, 1 hit
cd00051 EFh, 1 hit
cd00155 RasGEF, 1 hit
cd06224 REM, 1 hit
Gene3Di1.10.840.10, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR002219 PE/DAG-bd
IPR008937 Ras-like_GEF
IPR000651 Ras-like_Gua-exchang_fac_N
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
PANTHERiPTHR23113 PTHR23113, 1 hit
PfamiView protein in Pfam
PF00130 C1_1, 1 hit
PF13202 EF-hand_5, 1 hit
PF00617 RasGEF, 1 hit
PF00618 RasGEF_N, 1 hit
SMARTiView protein in SMART
SM00109 C1, 1 hit
SM00054 EFh, 2 hits
SM00147 RasGEF, 1 hit
SM00229 RasGEFN, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
SSF48366 SSF48366, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 2 hits
PS50222 EF_HAND_2, 2 hits
PS50009 RASGEF_CAT, 1 hit
PS50212 RASGEF_NTER, 1 hit
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7LDG7-1) [UniParc]FASTAAdd to basket
Also known as: CalDAG-GEFI, CalDAG-GEFIa

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGTLDLDKG CTVEELLRGC IEAFDDSGKV RDPQLVRMFL MMHPWYIPSS
60 70 80 90 100
QLAAKLLHIY QQSRKDNSNS LQVKTCHLVR YWISAFPAEF DLNPELAEQI
110 120 130 140 150
KELKALLDQE GNRRHSSLID IDSVPTYKWK RQVTQRNPVG QKKRKMSLLF
160 170 180 190 200
DHLEPMELAE HLTYLEYRSF CKILFQDYHS FVTHGCTVDN PVLERFISLF
210 220 230 240 250
NSVSQWVQLM ILSKPTAPQR ALVITHFVHV AEKLLQLQNF NTLMAVVGGL
260 270 280 290 300
SHSSISRLKE THSHVSPETI KLWEGLTELV TATGNYGNYR RRLAACVGFR
310 320 330 340 350
FPILGVHLKD LVALQLALPD WLDPARTRLN GAKMKQLFSI LEELAMVTSL
360 370 380 390 400
RPPVQANPDL LSLLTVSLDQ YQTEDELYQL SLQREPRSKS SPTSPTSCTP
410 420 430 440 450
PPRPPVLEEW TSAAKPKLDQ ALVVEHIEKM VESVFRNFDV DGDGHISQEE
460 470 480 490 500
FQIIRGNFPY LSAFGDLDQN QDGCISREEM VSYFLRSSSV LGGRMGFVHN
510 520 530 540 550
FQESNSLRPV ACRHCKALIL GIYKQGLKCR ACGVNCHKQC KDRLSVECRR
560 570 580 590 600
RAQSVSLEGS APSPSPMHSH HHRAFSFSLP RPGRRGSRPP EIREEEVQTV

EDGVFDIHL
Length:609
Mass (Da):69,248
Last modified:July 5, 2004 - v1
Checksum:i8B1321F864D24BC7
GO
Isoform 2 (identifier: Q7LDG7-2) [UniParc]FASTAAdd to basket
Also known as: RasGRP2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGTQRLCGRGTQGWPGSSEQHVQEATSSAGLHSGVDELGVRSEPGGRLPERSLGPAHPAPAAM

Show »
Length:671
Mass (Da):75,547
Checksum:i67B7BD2B4F4AED4D
GO
Isoform 3 (identifier: Q7LDG7-3) [UniParc]FASTAAdd to basket
Also known as: CalDAG-GEFIb

The sequence of this isoform differs from the canonical sequence as follows:
     125-125: P → CVGAEHRGLGGHSVSYTICA
     126-609: Missing.

Note: The corresponding protein is not undetectable.
Show »
Length:144
Mass (Da):16,203
Checksum:i23E5F426383B4F9A
GO
Isoform 4 (identifier: Q7LDG7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     590-590: P → PA

Note: No experimental confirmation available.
Show »
Length:610
Mass (Da):69,320
Checksum:i612917B4711357F9
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EM78E7EM78_HUMAN
RAS guanyl-releasing protein 2
RASGRP2
232Annotation score:
E7EWQ7E7EWQ7_HUMAN
RAS guanyl-releasing protein 2
RASGRP2
126Annotation score:
E7EMB4E7EMB4_HUMAN
RAS guanyl-releasing protein 2
RASGRP2
125Annotation score:
A6NJ28A6NJ28_HUMAN
RAS guanyl-releasing protein 2
RASGRP2
148Annotation score:
A6NHE2A6NHE2_HUMAN
RAS guanyl-releasing protein 2
RASGRP2
97Annotation score:
C9JZ82C9JZ82_HUMAN
RAS guanyl-releasing protein 2
RASGRP2
83Annotation score:
A8MVK8A8MVK8_HUMAN
RAS guanyl-releasing protein 2
RASGRP2
63Annotation score:
A8MTF9A8MTF9_HUMAN
RAS guanyl-releasing protein 2
RASGRP2
66Annotation score:
C9JKH6C9JKH6_HUMAN
RAS guanyl-releasing protein 2
RASGRP2
13Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_079614113 – 609Missing in BDPLT18. 1 PublicationAdd BLAST497
Natural variantiVAR_079615236 – 609Missing in BDPLT18; lack of mutant protein in platelets from a patient homozygous for the mutation. 1 PublicationAdd BLAST374
Natural variantiVAR_071474248G → W in BDPLT18; prevents Rap1 activation upon calcium stimulation; reduces platelet adhesion and spreading. 1 PublicationCorresponds to variant dbSNP:rs587777529EnsemblClinVar.1
Natural variantiVAR_079616296C → Y in BDPLT18; lack of mutant protein in platelets from a patient homozygous for the mutation. 1 Publication1
Natural variantiVAR_079617305G → D in BDPLT18. 1 Publication1
Natural variantiVAR_079618381S → F in BDPLT18; loss of guanyl-nucleotide exchange factor activity. 1 PublicationCorresponds to variant dbSNP:rs767965347Ensembl.1
Natural variantiVAR_038257493G → A. Corresponds to variant dbSNP:rs2301562Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0305741M → MGTQRLCGRGTQGWPGSSEQ HVQEATSSAGLHSGVDELGV RSEPGGRLPERSLGPAHPAP AAM in isoform 2. 1 Publication1
Alternative sequenceiVSP_030575125P → CVGAEHRGLGGHSVSYTICA in isoform 3. Curated1
Alternative sequenceiVSP_030576126 – 609Missing in isoform 3. CuratedAdd BLAST484
Alternative sequenceiVSP_054132590P → PA in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y12336 mRNA Translation: CAA73005.1
AF081194 mRNA Translation: AAC79698.1
U78170 mRNA Translation: AAD12741.1
AF043722 mRNA Translation: AAF07219.1
AF043723 mRNA Translation: AAF07220.1
AK092882 mRNA Translation: BAG52620.1
AP001462 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74281.1
BC117151 mRNA Translation: AAI17152.1
CCDSiCCDS31598.1 [Q7LDG7-1]
RefSeqiNP_001092140.1, NM_001098670.1 [Q7LDG7-1]
NP_001092141.1, NM_001098671.1 [Q7LDG7-1]
NP_001305327.1, NM_001318398.1
NP_722541.1, NM_153819.1 [Q7LDG7-1]
XP_011543022.1, XM_011544720.1 [Q7LDG7-4]
XP_011543023.1, XM_011544721.1 [Q7LDG7-4]
XP_011543024.1, XM_011544722.1 [Q7LDG7-4]
XP_011543025.1, XM_011544723.2 [Q7LDG7-4]
XP_016872573.1, XM_017017084.1 [Q7LDG7-4]
UniGeneiHs.99491

Genome annotation databases

EnsembliENST00000354024; ENSP00000338864; ENSG00000068831 [Q7LDG7-1]
ENST00000377494; ENSP00000366714; ENSG00000068831 [Q7LDG7-4]
ENST00000377497; ENSP00000366717; ENSG00000068831 [Q7LDG7-1]
ENST00000394432; ENSP00000377953; ENSG00000068831 [Q7LDG7-1]
GeneIDi10235
KEGGihsa:10235
UCSCiuc001oau.4 human [Q7LDG7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

RASGRP2base

RASGRP2 mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y12336 mRNA Translation: CAA73005.1
AF081194 mRNA Translation: AAC79698.1
U78170 mRNA Translation: AAD12741.1
AF043722 mRNA Translation: AAF07219.1
AF043723 mRNA Translation: AAF07220.1
AK092882 mRNA Translation: BAG52620.1
AP001462 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74281.1
BC117151 mRNA Translation: AAI17152.1
CCDSiCCDS31598.1 [Q7LDG7-1]
RefSeqiNP_001092140.1, NM_001098670.1 [Q7LDG7-1]
NP_001092141.1, NM_001098671.1 [Q7LDG7-1]
NP_001305327.1, NM_001318398.1
NP_722541.1, NM_153819.1 [Q7LDG7-1]
XP_011543022.1, XM_011544720.1 [Q7LDG7-4]
XP_011543023.1, XM_011544721.1 [Q7LDG7-4]
XP_011543024.1, XM_011544722.1 [Q7LDG7-4]
XP_011543025.1, XM_011544723.2 [Q7LDG7-4]
XP_016872573.1, XM_017017084.1 [Q7LDG7-4]
UniGeneiHs.99491

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MA2NMR-A417-497[»]
6AXFX-ray3.10A/C/E/G/I/K/M/O1-394[»]
ProteinModelPortaliQ7LDG7
SMRiQ7LDG7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115529, 2 interactors
IntActiQ7LDG7, 3 interactors
STRINGi9606.ENSP00000338864

PTM databases

iPTMnetiQ7LDG7
PhosphoSitePlusiQ7LDG7
SwissPalmiQ7LDG7

Polymorphism and mutation databases

BioMutaiRASGRP2
DMDMi74713056

Proteomic databases

EPDiQ7LDG7
MaxQBiQ7LDG7
PaxDbiQ7LDG7
PeptideAtlasiQ7LDG7
PRIDEiQ7LDG7
ProteomicsDBi68852
68853 [Q7LDG7-2]
68854 [Q7LDG7-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354024; ENSP00000338864; ENSG00000068831 [Q7LDG7-1]
ENST00000377494; ENSP00000366714; ENSG00000068831 [Q7LDG7-4]
ENST00000377497; ENSP00000366717; ENSG00000068831 [Q7LDG7-1]
ENST00000394432; ENSP00000377953; ENSG00000068831 [Q7LDG7-1]
GeneIDi10235
KEGGihsa:10235
UCSCiuc001oau.4 human [Q7LDG7-1]

Organism-specific databases

CTDi10235
DisGeNETi10235
EuPathDBiHostDB:ENSG00000068831.18
GeneCardsiRASGRP2
HGNCiHGNC:9879 RASGRP2
HPAiHPA015667
MalaCardsiRASGRP2
MIMi605577 gene
615888 phenotype
neXtProtiNX_Q7LDG7
OpenTargetsiENSG00000068831
Orphaneti420566 Bleeding disorder due to CalDAG-GEFI deficiency
PharmGKBiPA34241
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3417 Eukaryota
ENOG410XR96 LUCA
GeneTreeiENSGT00880000137870
HOGENOMiHOG000293171
HOVERGENiHBG007513
InParanoidiQ7LDG7
KOiK12361
OMAiMISYFLR
OrthoDBiEOG091G03RN
PhylomeDBiQ7LDG7
TreeFamiTF312918

Enzyme and pathway databases

ReactomeiR-HSA-114508 Effects of PIP2 hydrolysis
R-HSA-2871837 FCERI mediated NF-kB activation
R-HSA-354192 Integrin alphaIIb beta3 signaling
R-HSA-392517 Rap1 signalling

Miscellaneous databases

GeneWikiiRASGRP2
GenomeRNAii10235
PROiPR:Q7LDG7
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000068831 Expressed in 208 organ(s), highest expression level in blood
CleanExiHS_RASGRP2
ExpressionAtlasiQ7LDG7 baseline and differential
GenevisibleiQ7LDG7 HS

Family and domain databases

CDDicd00029 C1, 1 hit
cd00051 EFh, 1 hit
cd00155 RasGEF, 1 hit
cd06224 REM, 1 hit
Gene3Di1.10.840.10, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR002219 PE/DAG-bd
IPR008937 Ras-like_GEF
IPR000651 Ras-like_Gua-exchang_fac_N
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
PANTHERiPTHR23113 PTHR23113, 1 hit
PfamiView protein in Pfam
PF00130 C1_1, 1 hit
PF13202 EF-hand_5, 1 hit
PF00617 RasGEF, 1 hit
PF00618 RasGEF_N, 1 hit
SMARTiView protein in SMART
SM00109 C1, 1 hit
SM00054 EFh, 2 hits
SM00147 RasGEF, 1 hit
SM00229 RasGEFN, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
SSF48366 SSF48366, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 2 hits
PS50222 EF_HAND_2, 2 hits
PS50009 RASGEF_CAT, 1 hit
PS50212 RASGEF_NTER, 1 hit
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiGRP2_HUMAN
AccessioniPrimary (citable) accession number: Q7LDG7
Secondary accession number(s): A6NDC7, O00538, Q9UL65
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: July 5, 2004
Last modified: November 7, 2018
This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again