Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 139 (16 Oct 2019)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Basic leucine zipper and W2 domain-containing protein 1

Gene

BZW1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enhances histone H4 gene transcription but does not seem to bind DNA directly.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Basic leucine zipper and W2 domain-containing protein 1
Alternative name(s):
Protein Orf
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BZW1
Synonyms:BZAP45, KIAA0005
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18380 BZW1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7L1Q6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9689

Open Targets

More...
OpenTargetsi
ENSG00000082153

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38535

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q7L1Q6

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BZW1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74738534

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002546091 – 419Basic leucine zipper and W2 domain-containing protein 1Add BLAST419

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei12PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki368Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei411PhosphoserineCombined sources1
Modified residuei413PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7L1Q6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q7L1Q6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q7L1Q6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q7L1Q6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7L1Q6

PeptideAtlas

More...
PeptideAtlasi
Q7L1Q6

PRoteomics IDEntifications database

More...
PRIDEi
Q7L1Q6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
68744 [Q7L1Q6-1]
68745 [Q7L1Q6-2]
68746 [Q7L1Q6-3]
68747 [Q7L1Q6-4]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q7L1Q6-1 [Q7L1Q6-1]
Q7L1Q6-2 [Q7L1Q6-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7L1Q6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7L1Q6

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q7L1Q6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in day 3 embryo.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000082153 Expressed in 231 organ(s), highest expression level in amniotic fluid

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7L1Q6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7L1Q6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA047288
HPA053272

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115042, 50 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q7L1Q6

Protein interaction database and analysis system

More...
IntActi
Q7L1Q6, 24 interactors

Molecular INTeraction database

More...
MINTi
Q7L1Q6

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000394316

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7L1Q6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini247 – 414W2PROSITE-ProRule annotationAdd BLAST168

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the BZW family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2297 Eukaryota
ENOG410XR08 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000012561

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000252932

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7L1Q6

Identification of Orthologs from Complete Genome Data

More...
OMAi
IIWSSVM

Database of Orthologous Groups

More...
OrthoDBi
653740at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7L1Q6

TreeFam database of animal gene trees

More...
TreeFami
TF324313

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.180, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold
IPR016021 MIF4-like_sf
IPR003307 W2_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02020 W2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00515 eIF5C, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51363 W2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7L1Q6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNNQKQQKPT LSGQRFKTRK RDEKERFDPT QFQDCIIQGL TETGTDLEAV
60 70 80 90 100
AKFLDASGAK LDYRRYAETL FDILVAGGML APGGTLADDM MRTDVCVFAA
110 120 130 140 150
QEDLETMQAF AQVFNKLIRR YKYLEKGFED EVKKLLLFLK GFSESERNKL
160 170 180 190 200
AMLTGVLLAN GTLNASILNS LYNENLVKEG VSAAFAVKLF KSWINEKDIN
210 220 230 240 250
AVAASLRKVS MDNRLMELFP ANKQSVEHFT KYFTEAGLKE LSEYVRNQQT
260 270 280 290 300
IGARKELQKE LQEQMSRGDP FKDIILYVKE EMKKNNIPEP VVIGIVWSSV
310 320 330 340 350
MSTVEWNKKE ELVAEQAIKH LKQYSPLLAA FTTQGQSELT LLLKIQEYCY
360 370 380 390 400
DNIHFMKAFQ KIVVLFYKAE VLSEEPILKW YKDAHVAKGK SVFLEQMKKF
410
VEWLKNAEEE SESEAEEGD
Length:419
Mass (Da):48,043
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9E952D52F5796F60
GO
Isoform 2 (identifier: Q7L1Q6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     286-351: Missing.

Note: No experimental confirmation available.
Show »
Length:353
Mass (Da):40,539
Checksum:i1BD26FB298F41F56
GO
Isoform 3 (identifier: Q7L1Q6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYGAPGAPAQSASVTVVRSLRRPPPQATGVSFM

Note: No experimental confirmation available.
Show »
Length:451
Mass (Da):51,282
Checksum:i654A82C361BECEB7
GO
Isoform 4 (identifier: Q7L1Q6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVSFM

Note: No experimental confirmation available.
Show »
Length:423
Mass (Da):48,508
Checksum:iCCE2BA486ED06D43
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9IZ80C9IZ80_HUMAN
Basic leucine zipper and W2 domain-...
BZW1
294Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JV57C9JV57_HUMAN
Basic leucine zipper and W2 domain-...
BZW1
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JFN4C9JFN4_HUMAN
Basic leucine zipper and W2 domain-...
BZW1
216Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J188C9J188_HUMAN
Basic leucine zipper and W2 domain-...
BZW1
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JWF5C9JWF5_HUMAN
Basic leucine zipper and W2 domain-...
BZW1
161Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y503H0Y503_HUMAN
Basic leucine zipper and W2 domain-...
BZW1
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA02795 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0435681M → MYGAPGAPAQSASVTVVRSL RRPPPQATGVSFM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0435691M → MVSFM in isoform 4. 1 Publication1
Alternative sequenceiVSP_021266286 – 351Missing in isoform 2. 1 PublicationAdd BLAST66

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D13630 mRNA Translation: BAA02795.2 Different initiation.
AK297227 mRNA Translation: BAG59710.1
AK301511 mRNA Translation: BAG63019.1
AC007163 Genomic DNA Translation: AAX93286.1
BC001804 mRNA Translation: AAH01804.1
BC026303 mRNA Translation: AAH26303.1
Z70221 mRNA Translation: CAA94180.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS56154.1 [Q7L1Q6-4]
CCDS56155.1 [Q7L1Q6-3]
CCDS56156.1 [Q7L1Q6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001193996.1, NM_001207067.1 [Q7L1Q6-1]
NP_001193997.1, NM_001207068.2 [Q7L1Q6-3]
NP_001193998.1, NM_001207069.1 [Q7L1Q6-4]
NP_001308617.1, NM_001321688.1 [Q7L1Q6-1]
NP_001308619.1, NM_001321690.1 [Q7L1Q6-1]
NP_001308620.1, NM_001321691.1
NP_001308622.1, NM_001321693.1
NP_001308623.1, NM_001321694.1
NP_055485.2, NM_014670.3 [Q7L1Q6-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000409226; ENSP00000386837; ENSG00000082153 [Q7L1Q6-4]
ENST00000409600; ENSP00000386474; ENSG00000082153 [Q7L1Q6-1]
ENST00000452790; ENSP00000394316; ENSG00000082153 [Q7L1Q6-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9689

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9689

UCSC genome browser

More...
UCSCi
uc002uwc.4 human [Q7L1Q6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13630 mRNA Translation: BAA02795.2 Different initiation.
AK297227 mRNA Translation: BAG59710.1
AK301511 mRNA Translation: BAG63019.1
AC007163 Genomic DNA Translation: AAX93286.1
BC001804 mRNA Translation: AAH01804.1
BC026303 mRNA Translation: AAH26303.1
Z70221 mRNA Translation: CAA94180.1
CCDSiCCDS56154.1 [Q7L1Q6-4]
CCDS56155.1 [Q7L1Q6-3]
CCDS56156.1 [Q7L1Q6-1]
RefSeqiNP_001193996.1, NM_001207067.1 [Q7L1Q6-1]
NP_001193997.1, NM_001207068.2 [Q7L1Q6-3]
NP_001193998.1, NM_001207069.1 [Q7L1Q6-4]
NP_001308617.1, NM_001321688.1 [Q7L1Q6-1]
NP_001308619.1, NM_001321690.1 [Q7L1Q6-1]
NP_001308620.1, NM_001321691.1
NP_001308622.1, NM_001321693.1
NP_001308623.1, NM_001321694.1
NP_055485.2, NM_014670.3 [Q7L1Q6-2]

3D structure databases

SMRiQ7L1Q6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi115042, 50 interactors
CORUMiQ7L1Q6
IntActiQ7L1Q6, 24 interactors
MINTiQ7L1Q6
STRINGi9606.ENSP00000394316

PTM databases

iPTMnetiQ7L1Q6
PhosphoSitePlusiQ7L1Q6
SwissPalmiQ7L1Q6

Polymorphism and mutation databases

BioMutaiBZW1
DMDMi74738534

Proteomic databases

EPDiQ7L1Q6
jPOSTiQ7L1Q6
MassIVEiQ7L1Q6
MaxQBiQ7L1Q6
PaxDbiQ7L1Q6
PeptideAtlasiQ7L1Q6
PRIDEiQ7L1Q6
ProteomicsDBi68744 [Q7L1Q6-1]
68745 [Q7L1Q6-2]
68746 [Q7L1Q6-3]
68747 [Q7L1Q6-4]
TopDownProteomicsiQ7L1Q6-1 [Q7L1Q6-1]
Q7L1Q6-2 [Q7L1Q6-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9689

Genome annotation databases

EnsembliENST00000409226; ENSP00000386837; ENSG00000082153 [Q7L1Q6-4]
ENST00000409600; ENSP00000386474; ENSG00000082153 [Q7L1Q6-1]
ENST00000452790; ENSP00000394316; ENSG00000082153 [Q7L1Q6-3]
GeneIDi9689
KEGGihsa:9689
UCSCiuc002uwc.4 human [Q7L1Q6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9689
DisGeNETi9689

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BZW1
HGNCiHGNC:18380 BZW1
HPAiHPA047288
HPA053272
neXtProtiNX_Q7L1Q6
OpenTargetsiENSG00000082153
PharmGKBiPA38535

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2297 Eukaryota
ENOG410XR08 LUCA
GeneTreeiENSGT00390000012561
HOGENOMiHOG000252932
InParanoidiQ7L1Q6
OMAiIIWSSVM
OrthoDBi653740at2759
PhylomeDBiQ7L1Q6
TreeFamiTF324313

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BZW1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
BZW1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9689
PharosiQ7L1Q6

Protein Ontology

More...
PROi
PR:Q7L1Q6

Gene expression databases

BgeeiENSG00000082153 Expressed in 231 organ(s), highest expression level in amniotic fluid
ExpressionAtlasiQ7L1Q6 baseline and differential
GenevisibleiQ7L1Q6 HS

Family and domain databases

Gene3Di1.25.40.180, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR016021 MIF4-like_sf
IPR003307 W2_domain
PfamiView protein in Pfam
PF02020 W2, 1 hit
SMARTiView protein in SMART
SM00515 eIF5C, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51363 W2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBZW1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7L1Q6
Secondary accession number(s): B4DLZ8
, B4DWF7, Q14281, Q15394, Q9BUY0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: July 5, 2004
Last modified: October 16, 2019
This is version 139 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again