Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Basic leucine zipper and W2 domain-containing protein 1

Gene

BZW1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Enhances histone H4 gene transcription but does not seem to bind DNA directly.1 Publication

GO - Molecular functioni

Keywordsi

Molecular functionActivator
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Basic leucine zipper and W2 domain-containing protein 1
Alternative name(s):
Protein Orf
Gene namesi
Name:BZW1
Synonyms:BZAP45, KIAA0005
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000082153.17
HGNCiHGNC:18380 BZW1
neXtProtiNX_Q7L1Q6

Subcellular locationi

Pathology & Biotechi

Organism-specific databases

DisGeNETi9689
OpenTargetsiENSG00000082153
PharmGKBiPA38535

Polymorphism and mutation databases

BioMutaiBZW1
DMDMi74738534

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002546091 – 419Basic leucine zipper and W2 domain-containing protein 1Add BLAST419

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei12PhosphoserineCombined sources1
Cross-linki368Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei411PhosphoserineCombined sources1
Modified residuei413PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ7L1Q6
MaxQBiQ7L1Q6
PaxDbiQ7L1Q6
PeptideAtlasiQ7L1Q6
PRIDEiQ7L1Q6
ProteomicsDBi68744
68745 [Q7L1Q6-2]
68746 [Q7L1Q6-3]
68747 [Q7L1Q6-4]
TopDownProteomicsiQ7L1Q6-1 [Q7L1Q6-1]
Q7L1Q6-2 [Q7L1Q6-2]

PTM databases

iPTMnetiQ7L1Q6
PhosphoSitePlusiQ7L1Q6
SwissPalmiQ7L1Q6

Expressioni

Developmental stagei

Expressed in day 3 embryo.1 Publication

Gene expression databases

BgeeiENSG00000082153 Expressed in 231 organ(s), highest expression level in amniotic fluid
CleanExiHS_BZW1
ExpressionAtlasiQ7L1Q6 baseline and differential
GenevisibleiQ7L1Q6 HS

Organism-specific databases

HPAiHPA047288
HPA053272

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115042, 46 interactors
CORUMiQ7L1Q6
IntActiQ7L1Q6, 14 interactors
MINTiQ7L1Q6
STRINGi9606.ENSP00000394316

Structurei

3D structure databases

ProteinModelPortaliQ7L1Q6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini247 – 414W2PROSITE-ProRule annotationAdd BLAST168

Sequence similaritiesi

Belongs to the BZW family.Curated

Phylogenomic databases

eggNOGiKOG2297 Eukaryota
ENOG410XR08 LUCA
GeneTreeiENSGT00390000012561
HOGENOMiHOG000252932
HOVERGENiHBG080940
InParanoidiQ7L1Q6
OMAiMTALWIS
OrthoDBiEOG091G090E
PhylomeDBiQ7L1Q6
TreeFamiTF324313

Family and domain databases

Gene3Di1.25.40.180, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR016021 MIF4-like_sf
IPR003307 W2_domain
PfamiView protein in Pfam
PF02020 W2, 1 hit
SMARTiView protein in SMART
SM00515 eIF5C, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51363 W2, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7L1Q6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNNQKQQKPT LSGQRFKTRK RDEKERFDPT QFQDCIIQGL TETGTDLEAV
60 70 80 90 100
AKFLDASGAK LDYRRYAETL FDILVAGGML APGGTLADDM MRTDVCVFAA
110 120 130 140 150
QEDLETMQAF AQVFNKLIRR YKYLEKGFED EVKKLLLFLK GFSESERNKL
160 170 180 190 200
AMLTGVLLAN GTLNASILNS LYNENLVKEG VSAAFAVKLF KSWINEKDIN
210 220 230 240 250
AVAASLRKVS MDNRLMELFP ANKQSVEHFT KYFTEAGLKE LSEYVRNQQT
260 270 280 290 300
IGARKELQKE LQEQMSRGDP FKDIILYVKE EMKKNNIPEP VVIGIVWSSV
310 320 330 340 350
MSTVEWNKKE ELVAEQAIKH LKQYSPLLAA FTTQGQSELT LLLKIQEYCY
360 370 380 390 400
DNIHFMKAFQ KIVVLFYKAE VLSEEPILKW YKDAHVAKGK SVFLEQMKKF
410
VEWLKNAEEE SESEAEEGD
Length:419
Mass (Da):48,043
Last modified:July 5, 2004 - v1
Checksum:i9E952D52F5796F60
GO
Isoform 2 (identifier: Q7L1Q6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     286-351: Missing.

Note: No experimental confirmation available.
Show »
Length:353
Mass (Da):40,539
Checksum:i1BD26FB298F41F56
GO
Isoform 3 (identifier: Q7L1Q6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYGAPGAPAQSASVTVVRSLRRPPPQATGVSFM

Note: No experimental confirmation available.
Show »
Length:451
Mass (Da):51,282
Checksum:i654A82C361BECEB7
GO
Isoform 4 (identifier: Q7L1Q6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVSFM

Note: No experimental confirmation available.
Show »
Length:423
Mass (Da):48,508
Checksum:iCCE2BA486ED06D43
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9IZ80C9IZ80_HUMAN
Basic leucine zipper and W2 domain-...
BZW1
294Annotation score:
H0Y503H0Y503_HUMAN
Basic leucine zipper and W2 domain-...
BZW1
135Annotation score:
C9JFN4C9JFN4_HUMAN
Basic leucine zipper and W2 domain-...
BZW1
216Annotation score:
C9JV57C9JV57_HUMAN
Basic leucine zipper and W2 domain-...
BZW1
116Annotation score:
C9J188C9J188_HUMAN
Basic leucine zipper and W2 domain-...
BZW1
154Annotation score:
C9JWF5C9JWF5_HUMAN
Basic leucine zipper and W2 domain-...
BZW1
161Annotation score:

Sequence cautioni

The sequence BAA02795 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0435681M → MYGAPGAPAQSASVTVVRSL RRPPPQATGVSFM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0435691M → MVSFM in isoform 4. 1 Publication1
Alternative sequenceiVSP_021266286 – 351Missing in isoform 2. 1 PublicationAdd BLAST66

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13630 mRNA Translation: BAA02795.2 Different initiation.
AK297227 mRNA Translation: BAG59710.1
AK301511 mRNA Translation: BAG63019.1
AC007163 Genomic DNA Translation: AAX93286.1
BC001804 mRNA Translation: AAH01804.1
BC026303 mRNA Translation: AAH26303.1
Z70221 mRNA Translation: CAA94180.1
CCDSiCCDS56154.1 [Q7L1Q6-4]
CCDS56155.1 [Q7L1Q6-3]
CCDS56156.1 [Q7L1Q6-1]
RefSeqiNP_001193996.1, NM_001207067.1 [Q7L1Q6-1]
NP_001193997.1, NM_001207068.2 [Q7L1Q6-3]
NP_001193998.1, NM_001207069.1 [Q7L1Q6-4]
NP_001308617.1, NM_001321688.1 [Q7L1Q6-1]
NP_001308619.1, NM_001321690.1 [Q7L1Q6-1]
NP_001308620.1, NM_001321691.1
NP_001308622.1, NM_001321693.1
NP_001308623.1, NM_001321694.1
NP_055485.2, NM_014670.3 [Q7L1Q6-2]
UniGeneiHs.355983
Hs.736074

Genome annotation databases

EnsembliENST00000409226; ENSP00000386837; ENSG00000082153 [Q7L1Q6-4]
ENST00000409600; ENSP00000386474; ENSG00000082153 [Q7L1Q6-1]
ENST00000452790; ENSP00000394316; ENSG00000082153 [Q7L1Q6-3]
GeneIDi9689
KEGGihsa:9689
UCSCiuc002uwc.4 human [Q7L1Q6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13630 mRNA Translation: BAA02795.2 Different initiation.
AK297227 mRNA Translation: BAG59710.1
AK301511 mRNA Translation: BAG63019.1
AC007163 Genomic DNA Translation: AAX93286.1
BC001804 mRNA Translation: AAH01804.1
BC026303 mRNA Translation: AAH26303.1
Z70221 mRNA Translation: CAA94180.1
CCDSiCCDS56154.1 [Q7L1Q6-4]
CCDS56155.1 [Q7L1Q6-3]
CCDS56156.1 [Q7L1Q6-1]
RefSeqiNP_001193996.1, NM_001207067.1 [Q7L1Q6-1]
NP_001193997.1, NM_001207068.2 [Q7L1Q6-3]
NP_001193998.1, NM_001207069.1 [Q7L1Q6-4]
NP_001308617.1, NM_001321688.1 [Q7L1Q6-1]
NP_001308619.1, NM_001321690.1 [Q7L1Q6-1]
NP_001308620.1, NM_001321691.1
NP_001308622.1, NM_001321693.1
NP_001308623.1, NM_001321694.1
NP_055485.2, NM_014670.3 [Q7L1Q6-2]
UniGeneiHs.355983
Hs.736074

3D structure databases

ProteinModelPortaliQ7L1Q6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115042, 46 interactors
CORUMiQ7L1Q6
IntActiQ7L1Q6, 14 interactors
MINTiQ7L1Q6
STRINGi9606.ENSP00000394316

PTM databases

iPTMnetiQ7L1Q6
PhosphoSitePlusiQ7L1Q6
SwissPalmiQ7L1Q6

Polymorphism and mutation databases

BioMutaiBZW1
DMDMi74738534

Proteomic databases

EPDiQ7L1Q6
MaxQBiQ7L1Q6
PaxDbiQ7L1Q6
PeptideAtlasiQ7L1Q6
PRIDEiQ7L1Q6
ProteomicsDBi68744
68745 [Q7L1Q6-2]
68746 [Q7L1Q6-3]
68747 [Q7L1Q6-4]
TopDownProteomicsiQ7L1Q6-1 [Q7L1Q6-1]
Q7L1Q6-2 [Q7L1Q6-2]

Protocols and materials databases

DNASUi9689
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000409226; ENSP00000386837; ENSG00000082153 [Q7L1Q6-4]
ENST00000409600; ENSP00000386474; ENSG00000082153 [Q7L1Q6-1]
ENST00000452790; ENSP00000394316; ENSG00000082153 [Q7L1Q6-3]
GeneIDi9689
KEGGihsa:9689
UCSCiuc002uwc.4 human [Q7L1Q6-1]

Organism-specific databases

CTDi9689
DisGeNETi9689
EuPathDBiHostDB:ENSG00000082153.17
GeneCardsiBZW1
HGNCiHGNC:18380 BZW1
HPAiHPA047288
HPA053272
neXtProtiNX_Q7L1Q6
OpenTargetsiENSG00000082153
PharmGKBiPA38535
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2297 Eukaryota
ENOG410XR08 LUCA
GeneTreeiENSGT00390000012561
HOGENOMiHOG000252932
HOVERGENiHBG080940
InParanoidiQ7L1Q6
OMAiMTALWIS
OrthoDBiEOG091G090E
PhylomeDBiQ7L1Q6
TreeFamiTF324313

Miscellaneous databases

ChiTaRSiBZW1 human
GeneWikiiBZW1
GenomeRNAii9689
PROiPR:Q7L1Q6

Gene expression databases

BgeeiENSG00000082153 Expressed in 231 organ(s), highest expression level in amniotic fluid
CleanExiHS_BZW1
ExpressionAtlasiQ7L1Q6 baseline and differential
GenevisibleiQ7L1Q6 HS

Family and domain databases

Gene3Di1.25.40.180, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR016021 MIF4-like_sf
IPR003307 W2_domain
PfamiView protein in Pfam
PF02020 W2, 1 hit
SMARTiView protein in SMART
SM00515 eIF5C, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51363 W2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiBZW1_HUMAN
AccessioniPrimary (citable) accession number: Q7L1Q6
Secondary accession number(s): B4DLZ8
, B4DWF7, Q14281, Q15394, Q9BUY0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: July 5, 2004
Last modified: November 7, 2018
This is version 132 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again