Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 172 (02 Jun 2021)
Sequence version 2 (31 Aug 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Transcription elongation factor SPT6

Gene

SUPT6H

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription elongation factor which binds histone H3 and plays a key role in the regulation of transcription elongation and mRNA processing. Enhances the transcription elongation by RNA polymerase II (RNAPII) and is also required for the efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. Besides chaperoning histones in transcription, acts to transport and splice mRNA by forming a complex with IWS1 and the C-terminal domain (CTD) of the RNAPII subunit RPB1 (POLR2A). The SUPT6H:IWS1:CTD complex recruits mRNA export factors (ALYREF/THOC4, EXOSC10) as well as histone modifying enzymes (such as SETD2), to ensure proper mRNA splicing, efficient mRNA export and elongation-coupled H3K36 methylation, a signature chromatin mark of active transcription. SUPT6H via its association with SETD1A, regulates both class-switch recombination and somatic hypermutation through formation of H3K4me3 epigenetic marks on activation-induced cytidine deaminase (AICDA) target loci. Promotes the activation of the myogenic gene program by entailing erasure of the repressive H3K27me3 epigenetic mark through stabilization of the chromatin interaction of the H3K27 demethylase KDM6A.

5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone
Biological processHost-virus interaction, mRNA processing, mRNA splicing, mRNA transport, Transcription, Transcription regulation, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q7KZ85

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-112382, Formation of RNA Pol II elongation complex
R-HSA-674695, RNA Polymerase II Pre-transcription Events
R-HSA-75955, RNA Polymerase II Transcription Elongation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q7KZ85

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription elongation factor SPT6
Short name:
hSPT6
Alternative name(s):
Histone chaperone suppressor of Ty6
Tat-cotransactivator 2 protein
Short name:
Tat-CT2 protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SUPT6H
Synonyms:KIAA0162, SPT6H
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11470, SUPT6H

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601333, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7KZ85

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000109111.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000109111

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36256

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q7KZ85, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SUPT6H

Domain mapping of disease mutations (DMDM)

More...
DMDMi
51701986

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000721712 – 1726Transcription elongation factor SPT6Add BLAST1725

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei7PhosphoserineCombined sources1
Modified residuei12PhosphoserineCombined sources1
Modified residuei73PhosphoserineCombined sources1
Modified residuei78PhosphoserineBy similarity1
Modified residuei91PhosphoserineBy similarity1
Modified residuei125PhosphoserineCombined sources1
Modified residuei267PhosphoserineCombined sources1
Modified residuei743N6-acetyllysineCombined sources1
Modified residuei1515PhosphotyrosineCombined sources1
Modified residuei1523PhosphothreonineCombined sources1
Modified residuei1526PhosphoserineCombined sources1
Modified residuei1528PhosphoserineCombined sources1
Modified residuei1532PhosphothreonineCombined sources1
Modified residuei1535PhosphoserineCombined sources1
Modified residuei1539PhosphothreonineCombined sources1
Modified residuei1676N6-acetyllysineCombined sources1
Modified residuei1697PhosphothreonineCombined sources1
Modified residuei1701PhosphoserineCombined sources1
Modified residuei1703PhosphoserineCombined sources1
Modified residuei1709PhosphothreonineBy similarity1
Modified residuei1718PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7KZ85

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q7KZ85

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q7KZ85

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q7KZ85

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7KZ85

PeptideAtlas

More...
PeptideAtlasi
Q7KZ85

PRoteomics IDEntifications database

More...
PRIDEi
Q7KZ85

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
68703 [Q7KZ85-1]
68704 [Q7KZ85-2]
68705 [Q7KZ85-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q7KZ85, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7KZ85

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q7KZ85

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7KZ85

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000109111, Expressed in sural nerve and 235 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7KZ85, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7KZ85, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000109111, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RNA polymerase II and the DRB sensitivity-inducing factor complex (DSIF complex), which is composed of SUPT5H and SUPT4H1.

Interacts with KDM6A (By similarity).

Interacts (via SH2 domain) with SETD1A (By similarity).

Interacts (via SH2 domain) with POLR2A phosphorylated at 'Ser-2'.

Interacts with IWS1, AICDA and PAAF1.

Interacts with histone H2B and H3.

Interacts with WDR43 (By similarity).

By similarity6 Publications

(Microbial infection) Interacts with human cytomegalovirus/HHV-5 protein UL69.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
112698, 124 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q7KZ85

Database of interacting proteins

More...
DIPi
DIP-42615N

Protein interaction database and analysis system

More...
IntActi
Q7KZ85, 58 interactors

Molecular INTeraction database

More...
MINTi
Q7KZ85

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000319104

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q7KZ85, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11726
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7KZ85

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1213 – 1282S1 motifPROSITE-ProRule annotationAdd BLAST70
Domaini1325 – 1431SH2PROSITE-ProRule annotationAdd BLAST107

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 199DisorderedSequence analysisAdd BLAST199
Regioni2 – 916Interaction with PAAF11 PublicationAdd BLAST915
Regioni2 – 485Interaction with IWS1By similarityAdd BLAST484
Regioni317 – 1300Interaction with KDM6ABy similarityAdd BLAST984
Regioni484 – 520DisorderedSequence analysisAdd BLAST37
Regioni1633 – 1726Interaction with histone H2B and H31 PublicationAdd BLAST94
Regioni1636 – 1726DisorderedSequence analysisAdd BLAST91

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 18Acidic residuesSequence analysisAdd BLAST18
Compositional biasi33 – 48Acidic residuesSequence analysisAdd BLAST16
Compositional biasi59 – 77Acidic residuesSequence analysisAdd BLAST19
Compositional biasi78 – 96Basic and acidic residuesSequence analysisAdd BLAST19
Compositional biasi166 – 186Acidic residuesSequence analysisAdd BLAST21
Compositional biasi1636 – 1669Polar residuesSequence analysisAdd BLAST34
Compositional biasi1679 – 1695Basic and acidic residuesSequence analysisAdd BLAST17

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SPT6 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1856, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000047446

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001680_4_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7KZ85

Identification of Orthologs from Complete Genome Data

More...
OMAi
NTSPHSM

Database of Orthologous Groups

More...
OrthoDBi
56990at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7KZ85

TreeFam database of animal gene trees

More...
TreeFami
TF105956

Family and domain databases

Conserved Domains Database

More...
CDDi
cd09928, SH2_Cterm_SPT6_like, 1 hit
cd09918, SH2_Nterm_SPT6_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.505.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR041692, HHH_9
IPR012340, NA-bd_OB-fold
IPR012337, RNaseH-like_sf
IPR010994, RuvA_2-like
IPR022967, S1_dom
IPR003029, S1_domain
IPR000980, SH2
IPR036860, SH2_dom_sf
IPR028083, Spt6_acidic_N_dom
IPR032706, Spt6_HHH
IPR028088, Spt6_HTH_DNA-bd_dom
IPR035420, Spt6_SH2
IPR035018, Spt6_SH2_C
IPR035019, Spt6_SH2_N
IPR028231, Spt6_YqgF
IPR017072, TF_Spt6
IPR006641, YqgF/RNaseH-like_dom

The PANTHER Classification System

More...
PANTHERi
PTHR10145, PTHR10145, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14635, HHH_7, 1 hit
PF17674, HHH_9, 1 hit
PF14641, HTH_44, 1 hit
PF00575, S1, 1 hit
PF14633, SH2_2, 1 hit
PF14632, SPT6_acidic, 1 hit
PF14639, YqgF, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF036947, Spt6, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00316, S1, 1 hit
SM00252, SH2, 1 hit
SM00732, YqgFc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47781, SSF47781, 2 hits
SSF50249, SSF50249, 1 hit
SSF53098, SSF53098, 1 hit
SSF55550, SSF55550, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50126, S1, 1 hit
PS50001, SH2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7KZ85-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDFVESEAE ESEEEYNDEG EVVPRVTKKF VEEEDDDEEE EEENLDDQDE
60 70 80 90 100
QGNLKGFIND DDDEDEGEED EGSDSGDSED DVGHKKRKRT SFDDRLEDDD
110 120 130 140 150
FDLIEENLGV KVKRGQKYRR VKKMSDDEDD DEEEYGKEEH EKEAIAEEIF
160 170 180 190 200
QDGEGEEGQE AMEAPMAPPE EEEEDDEESD IDDFIVDDDG QPLKKPKWRK
210 220 230 240 250
KLPGYTDAAL QEAQEIFGVD FDYDEFEKYN EYDEELEEEY EYEDDEAEGE
260 270 280 290 300
IRVRPKKTTK KRVSRRSIFE MYEPSELESS HLTDQDNEIR ATDLPERFQL
310 320 330 340 350
RSIPVKGAED DELEEEADWI YRNAFATPTI SLQESCDYLD RGQPASSFSR
360 370 380 390 400
KGPSTIQKIK EALGFMRNQH FEVPFIAFYR KEYVEPELHI NDLWRVWQWD
410 420 430 440 450
EKWTQLRIRK ENLTRLFEKM QAYQYEQISA DPDKPLADGI RALDTTDMER
460 470 480 490 500
LKDVQSMDEL KDVYNHFLLY YGRDIPKMQN AAKASRKKLK RVREEGDEEG
510 520 530 540 550
EGDEAEDEEQ RGPELKQASR RDMYTICQSA GLDGLAKKFG LTPEQFGENL
560 570 580 590 600
RDSYQRHETE QFPAEPLELA KDYVCSQFPT PEAVLEGARY MVALQIAREP
610 620 630 640 650
LVRQVLRQTF QERAKLNITP TKKGRKDVDE AHYAYSFKYL KNKPVKELRD
660 670 680 690 700
DQFLKICLAE DEGLLTTDIS IDLKGVEGYG NDQTYFEEIK QFYYRDEFSH
710 720 730 740 750
QVQEWNRQRT MAIERALQQF LYVQMAKELK NKLLAEAKEY VIKACSRKLY
760 770 780 790 800
NWLRVAPYRP DQQVEEDDDF MDENQGKGIR VLGIAFSSAR DHPVFCALVN
810 820 830 840 850
GEGEVTDFLR LPHFTKRRTA WREEEREKKA QDIETLKKFL LNKKPHVVTV
860 870 880 890 900
AGENRDAQML IEDVKRIVHE LDQGQQLSSI GVELVDNELA ILYMNSKKSE
910 920 930 940 950
AEFRDYPPVL RQAVSLARRI QDPLIEFAQV CSSDEDILCL KFHPLQEHVV
960 970 980 990 1000
KEELLNALYC EFINRVNEVG VDVNRAIAHP YSQALIQYVC GLGPRKGTHL
1010 1020 1030 1040 1050
LKILKQNNTR LESRTQLVTM CHMGPKVFMN CAGFLKIDTA SLGDSTDSYI
1060 1070 1080 1090 1100
EVLDGSRVHP ETYEWARKMA VDALEYDESA EDANPAGALE EILENPERLK
1110 1120 1130 1140 1150
DLDLDAFAEE LERQGYGDKH ITLYDIRAEL SCRYKDLRTA YRSPNTEEIF
1160 1170 1180 1190 1200
NMLTKETPET FYIGKLIICN VTGIAHRRPQ GESYDQAIRN DETGLWQCPF
1210 1220 1230 1240 1250
CQQDNFPELS EVWNHFDSGS CPGQAIGVKT RLDNGVTGFI PTKFLSDKVV
1260 1270 1280 1290 1300
KRPEERVKVG MTVHCRIMKI DIEKFSADLT CRTSDLMDRN NEWKLPKDTY
1310 1320 1330 1340 1350
YDFDAEAADH KQEEDMKRKQ QRTTYIKRVI AHPSFHNINF KQAEKMMETM
1360 1370 1380 1390 1400
DQGDVIIRPS SKGENHLTVT WKVSDGIYQH VDVREEGKEN AFSLGATLWI
1410 1420 1430 1440 1450
NSEEFEDLDE IVARYVQPMA SFARDLLNHK YYQDCSGGDR KKLEELLIKT
1460 1470 1480 1490 1500
KKEKPTFIPY FICACKELPG KFLLGYQPRG KPRIEYVTVT PEGFRYRGQI
1510 1520 1530 1540 1550
FPTVNGLFRW FKDHYQDPVP GITPSSSSRT RTPASINATP ANINLADLTR
1560 1570 1580 1590 1600
AVNALPQNMT SQMFSAIAAV TGQGQNPNAT PAQWASSQYG YGGSGGGSSA
1610 1620 1630 1640 1650
YHVFPTPAQQ PVATPLMTPS YSYTTPSQPI TTPQYHQLQA STTPQSAQAQ
1660 1670 1680 1690 1700
PQPSSSSRQR QQQPKSNSHA AIDWGKMAEQ WLQEKEAERR KQKQRLTPRP
1710 1720
SPSPMIESTP MSIAGDATPL LDEMDR
Length:1,726
Mass (Da):199,073
Last modified:August 31, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF7EB22FA669EB030
GO
Isoform 2 (identifier: Q7KZ85-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1181: Missing.
     1182-1211: ESYDQAIRNDETGLWQCPFCQQDNFPELSE → MPSRGTRPEDSSVLIPTDNSTPHKEDLSSK

Show »
Length:545
Mass (Da):61,301
Checksum:i4BD128B2327CECE4
GO
Isoform 3 (identifier: Q7KZ85-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     617-1616: Missing.

Show »
Length:726
Mass (Da):84,632
Checksum:iBA3499B7CD6743BD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QS64J3QS64_HUMAN
Transcription elongation factor SPT...
SUPT6H
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EK85K7EK85_HUMAN
Transcription elongation factor SPT...
SUPT6H
53Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB18949 differs from that shown. Reason: Frameshift.Curated
The sequence AAC50821 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAH33074 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAA11479 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti61 – 73DDDED…EDEGS → ATAPGHPKLSEGR in AAC50821 (PubMed:8786132).CuratedAdd BLAST13
Sequence conflicti100 – 109DFDLIEENLG → LEDDDFLLNE in AAH33074 (PubMed:15489334).Curated10
Sequence conflicti988 – 994YVCGLGP → VCLWPGT in AAB18949 (PubMed:8786132).Curated7
Sequence conflicti1545L → P in AAH17105 (PubMed:15489334).Curated1
Sequence conflicti1627S → I in AAH17105 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0115051 – 1181Missing in isoform 2. 1 PublicationAdd BLAST1181
Alternative sequenceiVSP_011507617 – 1616Missing in isoform 3. 1 PublicationAdd BLAST1000
Alternative sequenceiVSP_0115061182 – 1211ESYDQ…PELSE → MPSRGTRPEDSSVLIPTDNS TPHKEDLSSK in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U38623 mRNA Translation: AAC99996.1
U38658 mRNA Translation: AAB18949.1 Frameshift.
U46691 mRNA Translation: AAC50821.1 Different initiation.
D79984 mRNA Translation: BAA11479.2 Different initiation.
CH471159 Genomic DNA Translation: EAW51117.1
BC003692 mRNA Translation: AAH03692.1
BC003696 mRNA Translation: AAH03696.1
BC017105 mRNA Translation: AAH17105.1
BC033074 mRNA Translation: AAH33074.1 Different initiation.
BC073963 mRNA Translation: AAH73963.1
BC136522 mRNA Translation: AAI36523.1
BC136524 mRNA Translation: AAI36525.1
BC150268 mRNA Translation: AAI50269.1
AF070532 mRNA Translation: AAC28631.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32596.1 [Q7KZ85-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001307684.1, NM_001320755.1 [Q7KZ85-1]
NP_003161.2, NM_003170.4 [Q7KZ85-1]
XP_016880467.1, XM_017024978.1 [Q7KZ85-1]
XP_016880468.1, XM_017024979.1 [Q7KZ85-1]
XP_016880469.1, XM_017024980.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000314616; ENSP00000319104; ENSG00000109111 [Q7KZ85-1]
ENST00000347486; ENSP00000338143; ENSG00000109111 [Q7KZ85-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6830

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6830

UCSC genome browser

More...
UCSCi
uc002hby.4, human [Q7KZ85-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U38623 mRNA Translation: AAC99996.1
U38658 mRNA Translation: AAB18949.1 Frameshift.
U46691 mRNA Translation: AAC50821.1 Different initiation.
D79984 mRNA Translation: BAA11479.2 Different initiation.
CH471159 Genomic DNA Translation: EAW51117.1
BC003692 mRNA Translation: AAH03692.1
BC003696 mRNA Translation: AAH03696.1
BC017105 mRNA Translation: AAH17105.1
BC033074 mRNA Translation: AAH33074.1 Different initiation.
BC073963 mRNA Translation: AAH73963.1
BC136522 mRNA Translation: AAI36523.1
BC136524 mRNA Translation: AAI36525.1
BC150268 mRNA Translation: AAI50269.1
AF070532 mRNA Translation: AAC28631.1
CCDSiCCDS32596.1 [Q7KZ85-1]
RefSeqiNP_001307684.1, NM_001320755.1 [Q7KZ85-1]
NP_003161.2, NM_003170.4 [Q7KZ85-1]
XP_016880467.1, XM_017024978.1 [Q7KZ85-1]
XP_016880468.1, XM_017024979.1 [Q7KZ85-1]
XP_016880469.1, XM_017024980.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6GMEX-ray1.80A/B1338-1520[»]
6GMHelectron microscopy3.10M1-1726[»]
6TEDelectron microscopy3.10M1-1726[»]
SMRiQ7KZ85
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi112698, 124 interactors
CORUMiQ7KZ85
DIPiDIP-42615N
IntActiQ7KZ85, 58 interactors
MINTiQ7KZ85
STRINGi9606.ENSP00000319104

PTM databases

GlyGeniQ7KZ85, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ7KZ85
MetOSiteiQ7KZ85
PhosphoSitePlusiQ7KZ85

Genetic variation databases

BioMutaiSUPT6H
DMDMi51701986

Proteomic databases

EPDiQ7KZ85
jPOSTiQ7KZ85
MassIVEiQ7KZ85
MaxQBiQ7KZ85
PaxDbiQ7KZ85
PeptideAtlasiQ7KZ85
PRIDEiQ7KZ85
ProteomicsDBi68703 [Q7KZ85-1]
68704 [Q7KZ85-2]
68705 [Q7KZ85-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
3242, 142 antibodies

The DNASU plasmid repository

More...
DNASUi
6830

Genome annotation databases

EnsembliENST00000314616; ENSP00000319104; ENSG00000109111 [Q7KZ85-1]
ENST00000347486; ENSP00000338143; ENSG00000109111 [Q7KZ85-1]
GeneIDi6830
KEGGihsa:6830
UCSCiuc002hby.4, human [Q7KZ85-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6830

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SUPT6H
HGNCiHGNC:11470, SUPT6H
HPAiENSG00000109111, Low tissue specificity
MIMi601333, gene
neXtProtiNX_Q7KZ85
OpenTargetsiENSG00000109111
PharmGKBiPA36256
VEuPathDBiHostDB:ENSG00000109111.14

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1856, Eukaryota
GeneTreeiENSGT00510000047446
HOGENOMiCLU_001680_4_0_1
InParanoidiQ7KZ85
OMAiNTSPHSM
OrthoDBi56990at2759
PhylomeDBiQ7KZ85
TreeFamiTF105956

Enzyme and pathway databases

PathwayCommonsiQ7KZ85
ReactomeiR-HSA-112382, Formation of RNA Pol II elongation complex
R-HSA-674695, RNA Polymerase II Pre-transcription Events
R-HSA-75955, RNA Polymerase II Transcription Elongation
SignaLinkiQ7KZ85

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
6830, 788 hits in 1013 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SUPT6H, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SUPT6H

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6830
PharosiQ7KZ85, Tbio

Protein Ontology

More...
PROi
PR:Q7KZ85
RNActiQ7KZ85, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000109111, Expressed in sural nerve and 235 other tissues
ExpressionAtlasiQ7KZ85, baseline and differential
GenevisibleiQ7KZ85, HS

Family and domain databases

CDDicd09928, SH2_Cterm_SPT6_like, 1 hit
cd09918, SH2_Nterm_SPT6_like, 1 hit
Gene3Di3.30.505.10, 2 hits
InterProiView protein in InterPro
IPR041692, HHH_9
IPR012340, NA-bd_OB-fold
IPR012337, RNaseH-like_sf
IPR010994, RuvA_2-like
IPR022967, S1_dom
IPR003029, S1_domain
IPR000980, SH2
IPR036860, SH2_dom_sf
IPR028083, Spt6_acidic_N_dom
IPR032706, Spt6_HHH
IPR028088, Spt6_HTH_DNA-bd_dom
IPR035420, Spt6_SH2
IPR035018, Spt6_SH2_C
IPR035019, Spt6_SH2_N
IPR028231, Spt6_YqgF
IPR017072, TF_Spt6
IPR006641, YqgF/RNaseH-like_dom
PANTHERiPTHR10145, PTHR10145, 1 hit
PfamiView protein in Pfam
PF14635, HHH_7, 1 hit
PF17674, HHH_9, 1 hit
PF14641, HTH_44, 1 hit
PF00575, S1, 1 hit
PF14633, SH2_2, 1 hit
PF14632, SPT6_acidic, 1 hit
PF14639, YqgF, 1 hit
PIRSFiPIRSF036947, Spt6, 1 hit
SMARTiView protein in SMART
SM00316, S1, 1 hit
SM00252, SH2, 1 hit
SM00732, YqgFc, 1 hit
SUPFAMiSSF47781, SSF47781, 2 hits
SSF50249, SSF50249, 1 hit
SSF53098, SSF53098, 1 hit
SSF55550, SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50126, S1, 1 hit
PS50001, SH2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPT6H_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7KZ85
Secondary accession number(s): A7E2B4
, Q15737, Q6GMQ4, Q7KYW9, Q7LDK4, Q8N526, Q92775, Q96AH3, Q9BTH9, Q9BTI2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: June 2, 2021
This is version 172 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again