Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription elongation factor SPT6

Gene

SUPT6H

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcription elongation factor which binds histone H3 and plays a key role in the regulation of transcription elongation and mRNA processing. Enhances the transcription elongation by RNA polymerase II (RNAPII) and is also required for the efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. Besides chaperoning histones in transcription, acts to transport and splice mRNA by forming a complex with IWS1 and the C-terminal domain (CTD) of the RNAPII subunit RPB1 (POLR2A). The SUPT6H:IWS1:CTD complex recruits mRNA export factors (ALYREF/THOC4, EXOSC10) as well as histone modifying enzymes (such as SETD2), to ensure proper mRNA splicing, efficient mRNA export and elongation-coupled H3K36 methylation, a signature chromatin mark of active transcription. SUPT6H via its association with SETD1A, regulates both class-switch recombination and somatic hypermutation through formation of H3K4me3 epigenetic marks on activation-induced cytidine deaminase (AICDA) target loci. Promotes the activation of the myogenic gene program by entailing erasure of the repressive H3K27me3 epigenetic mark through stabilization of the chromatin interaction of the H3K27 demethylase KDM6A.5 Publications

GO - Molecular functioni

  • DNA binding Source: InterPro
  • DNA-binding transcription factor activity Source: ProtInc
  • histone binding Source: UniProtKB
  • nucleosome binding Source: GO_Central
  • RNA binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionChaperone
Biological processHost-virus interaction, mRNA processing, mRNA splicing, mRNA transport, Transcription, Transcription regulation, Transport

Enzyme and pathway databases

ReactomeiR-HSA-112382 Formation of RNA Pol II elongation complex
R-HSA-674695 RNA Polymerase II Pre-transcription Events
R-HSA-75955 RNA Polymerase II Transcription Elongation
SignaLinkiQ7KZ85

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription elongation factor SPT6
Short name:
hSPT6
Alternative name(s):
Histone chaperone suppressor of Ty6
Tat-cotransactivator 2 protein
Short name:
Tat-CT2 protein
Gene namesi
Name:SUPT6H
Synonyms:KIAA0162, SPT6H
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000109111.14
HGNCiHGNC:11470 SUPT6H
MIMi601333 gene
neXtProtiNX_Q7KZ85

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000109111
PharmGKBiPA36256

Polymorphism and mutation databases

BioMutaiSUPT6H
DMDMi51701986

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000721712 – 1726Transcription elongation factor SPT6Add BLAST1725

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1
Modified residuei7PhosphoserineCombined sources1
Modified residuei12PhosphoserineCombined sources1
Modified residuei73PhosphoserineCombined sources1
Modified residuei78PhosphoserineBy similarity1
Modified residuei91PhosphoserineBy similarity1
Modified residuei125PhosphoserineCombined sources1
Modified residuei267PhosphoserineCombined sources1
Modified residuei743N6-acetyllysineCombined sources1
Modified residuei1515PhosphotyrosineCombined sources1
Modified residuei1523PhosphothreonineCombined sources1
Modified residuei1526PhosphoserineCombined sources1
Modified residuei1528PhosphoserineCombined sources1
Modified residuei1532PhosphothreonineCombined sources1
Modified residuei1535PhosphoserineCombined sources1
Modified residuei1539PhosphothreonineCombined sources1
Modified residuei1676N6-acetyllysineCombined sources1
Modified residuei1697PhosphothreonineCombined sources1
Modified residuei1701PhosphoserineCombined sources1
Modified residuei1703PhosphoserineCombined sources1
Modified residuei1709PhosphothreonineBy similarity1
Modified residuei1718PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ7KZ85
MaxQBiQ7KZ85
PaxDbiQ7KZ85
PeptideAtlasiQ7KZ85
PRIDEiQ7KZ85
ProteomicsDBi68703
68704 [Q7KZ85-2]
68705 [Q7KZ85-3]

PTM databases

iPTMnetiQ7KZ85
PhosphoSitePlusiQ7KZ85

Miscellaneous databases

PMAP-CutDBiQ7KZ85

Expressioni

Tissue specificityi

Ubiquitously expressed.

Gene expression databases

BgeeiENSG00000109111 Expressed in 224 organ(s), highest expression level in left lobe of thyroid gland
ExpressionAtlasiQ7KZ85 baseline and differential
GenevisibleiQ7KZ85 HS

Organism-specific databases

HPAiCAB012416
HPA036382

Interactioni

Subunit structurei

Interacts with RNA polymerase II and the DRB sensitivity-inducing factor complex (DSIF complex), which is composed of SUPT5H and SUPT4H1. Interacts with KDM6A (By similarity). Interacts (via SH2 domain) with SETD1A (By similarity). Interacts (via SH2 domain) with POLR2A phosphorylated at 'Ser-2'. Interacts with IWS1, AICDA and PAAF1. Interacts with histone H2B and H3.By similarity6 Publications
(Microbial infection) Interacts with human cytomegalovirus/HHV-5 protein UL69.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ERBB2P046262EBI-2515547,EBI-641062

GO - Molecular functioni

Protein-protein interaction databases

BioGridi112698, 87 interactors
CORUMiQ7KZ85
DIPiDIP-42615N
IntActiQ7KZ85, 31 interactors
MINTiQ7KZ85
STRINGi9606.ENSP00000319104

Structurei

Secondary structure

11726
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ7KZ85
SMRiQ7KZ85
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1213 – 1282S1 motifPROSITE-ProRule annotationAdd BLAST70
Domaini1325 – 1431SH2PROSITE-ProRule annotationAdd BLAST107

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni2 – 916Interaction with PAAF11 PublicationAdd BLAST915
Regioni2 – 485Interaction with IWS1By similarityAdd BLAST484
Regioni317 – 1300Interaction with KDM6ABy similarityAdd BLAST984
Regioni1633 – 1726Interaction with histone H2B and H31 PublicationAdd BLAST94

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi6 – 250Asp/Glu-richAdd BLAST245
Compositional biasi1525 – 1528Poly-Ser4
Compositional biasi1654 – 1657Poly-Ser4

Sequence similaritiesi

Belongs to the SPT6 family.Curated

Phylogenomic databases

eggNOGiKOG1856 Eukaryota
COG2183 LUCA
GeneTreeiENSGT00510000047446
HOVERGENiHBG093994
InParanoidiQ7KZ85
KOiK11292
OMAiNTSPHSM
OrthoDBiEOG091G00SW
PhylomeDBiQ7KZ85
TreeFamiTF105956

Family and domain databases

CDDicd09928 SH2_Cterm_SPT6_like, 1 hit
cd09918 SH2_Nterm_SPT6_like, 1 hit
Gene3Di3.30.505.10, 2 hits
InterProiView protein in InterPro
IPR012340 NA-bd_OB-fold
IPR012337 RNaseH-like_sf
IPR010994 RuvA_2-like
IPR022967 S1_dom
IPR003029 S1_domain
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR028083 Spt6_acidic_N_dom
IPR027999 Spt6_dom
IPR032706 Spt6_HHH
IPR028088 Spt6_HTH_DNA-bd_dom
IPR035420 Spt6_SH2
IPR035018 Spt6_SH2_C
IPR035019 Spt6_SH2_N
IPR028231 Spt6_YqgF
IPR017072 TF_Spt6
IPR006641 YqgF/RNaseH-like_dom
PANTHERiPTHR10145 PTHR10145, 1 hit
PfamiView protein in Pfam
PF14878 DLD, 1 hit
PF14635 HHH_7, 1 hit
PF14641 HTH_44, 1 hit
PF00575 S1, 1 hit
PF14633 SH2_2, 1 hit
PF14632 SPT6_acidic, 1 hit
PF14639 YqgF, 1 hit
PIRSFiPIRSF036947 Spt6, 1 hit
SMARTiView protein in SMART
SM00316 S1, 1 hit
SM00252 SH2, 1 hit
SM00732 YqgFc, 1 hit
SUPFAMiSSF47781 SSF47781, 2 hits
SSF50249 SSF50249, 1 hit
SSF53098 SSF53098, 1 hit
SSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50126 S1, 1 hit
PS50001 SH2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7KZ85-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDFVESEAE ESEEEYNDEG EVVPRVTKKF VEEEDDDEEE EEENLDDQDE
60 70 80 90 100
QGNLKGFIND DDDEDEGEED EGSDSGDSED DVGHKKRKRT SFDDRLEDDD
110 120 130 140 150
FDLIEENLGV KVKRGQKYRR VKKMSDDEDD DEEEYGKEEH EKEAIAEEIF
160 170 180 190 200
QDGEGEEGQE AMEAPMAPPE EEEEDDEESD IDDFIVDDDG QPLKKPKWRK
210 220 230 240 250
KLPGYTDAAL QEAQEIFGVD FDYDEFEKYN EYDEELEEEY EYEDDEAEGE
260 270 280 290 300
IRVRPKKTTK KRVSRRSIFE MYEPSELESS HLTDQDNEIR ATDLPERFQL
310 320 330 340 350
RSIPVKGAED DELEEEADWI YRNAFATPTI SLQESCDYLD RGQPASSFSR
360 370 380 390 400
KGPSTIQKIK EALGFMRNQH FEVPFIAFYR KEYVEPELHI NDLWRVWQWD
410 420 430 440 450
EKWTQLRIRK ENLTRLFEKM QAYQYEQISA DPDKPLADGI RALDTTDMER
460 470 480 490 500
LKDVQSMDEL KDVYNHFLLY YGRDIPKMQN AAKASRKKLK RVREEGDEEG
510 520 530 540 550
EGDEAEDEEQ RGPELKQASR RDMYTICQSA GLDGLAKKFG LTPEQFGENL
560 570 580 590 600
RDSYQRHETE QFPAEPLELA KDYVCSQFPT PEAVLEGARY MVALQIAREP
610 620 630 640 650
LVRQVLRQTF QERAKLNITP TKKGRKDVDE AHYAYSFKYL KNKPVKELRD
660 670 680 690 700
DQFLKICLAE DEGLLTTDIS IDLKGVEGYG NDQTYFEEIK QFYYRDEFSH
710 720 730 740 750
QVQEWNRQRT MAIERALQQF LYVQMAKELK NKLLAEAKEY VIKACSRKLY
760 770 780 790 800
NWLRVAPYRP DQQVEEDDDF MDENQGKGIR VLGIAFSSAR DHPVFCALVN
810 820 830 840 850
GEGEVTDFLR LPHFTKRRTA WREEEREKKA QDIETLKKFL LNKKPHVVTV
860 870 880 890 900
AGENRDAQML IEDVKRIVHE LDQGQQLSSI GVELVDNELA ILYMNSKKSE
910 920 930 940 950
AEFRDYPPVL RQAVSLARRI QDPLIEFAQV CSSDEDILCL KFHPLQEHVV
960 970 980 990 1000
KEELLNALYC EFINRVNEVG VDVNRAIAHP YSQALIQYVC GLGPRKGTHL
1010 1020 1030 1040 1050
LKILKQNNTR LESRTQLVTM CHMGPKVFMN CAGFLKIDTA SLGDSTDSYI
1060 1070 1080 1090 1100
EVLDGSRVHP ETYEWARKMA VDALEYDESA EDANPAGALE EILENPERLK
1110 1120 1130 1140 1150
DLDLDAFAEE LERQGYGDKH ITLYDIRAEL SCRYKDLRTA YRSPNTEEIF
1160 1170 1180 1190 1200
NMLTKETPET FYIGKLIICN VTGIAHRRPQ GESYDQAIRN DETGLWQCPF
1210 1220 1230 1240 1250
CQQDNFPELS EVWNHFDSGS CPGQAIGVKT RLDNGVTGFI PTKFLSDKVV
1260 1270 1280 1290 1300
KRPEERVKVG MTVHCRIMKI DIEKFSADLT CRTSDLMDRN NEWKLPKDTY
1310 1320 1330 1340 1350
YDFDAEAADH KQEEDMKRKQ QRTTYIKRVI AHPSFHNINF KQAEKMMETM
1360 1370 1380 1390 1400
DQGDVIIRPS SKGENHLTVT WKVSDGIYQH VDVREEGKEN AFSLGATLWI
1410 1420 1430 1440 1450
NSEEFEDLDE IVARYVQPMA SFARDLLNHK YYQDCSGGDR KKLEELLIKT
1460 1470 1480 1490 1500
KKEKPTFIPY FICACKELPG KFLLGYQPRG KPRIEYVTVT PEGFRYRGQI
1510 1520 1530 1540 1550
FPTVNGLFRW FKDHYQDPVP GITPSSSSRT RTPASINATP ANINLADLTR
1560 1570 1580 1590 1600
AVNALPQNMT SQMFSAIAAV TGQGQNPNAT PAQWASSQYG YGGSGGGSSA
1610 1620 1630 1640 1650
YHVFPTPAQQ PVATPLMTPS YSYTTPSQPI TTPQYHQLQA STTPQSAQAQ
1660 1670 1680 1690 1700
PQPSSSSRQR QQQPKSNSHA AIDWGKMAEQ WLQEKEAERR KQKQRLTPRP
1710 1720
SPSPMIESTP MSIAGDATPL LDEMDR
Length:1,726
Mass (Da):199,073
Last modified:August 31, 2004 - v2
Checksum:iF7EB22FA669EB030
GO
Isoform 2 (identifier: Q7KZ85-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1181: Missing.
     1182-1211: ESYDQAIRNDETGLWQCPFCQQDNFPELSE → MPSRGTRPEDSSVLIPTDNSTPHKEDLSSK

Show »
Length:545
Mass (Da):61,301
Checksum:i4BD128B2327CECE4
GO
Isoform 3 (identifier: Q7KZ85-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     617-1616: Missing.

Show »
Length:726
Mass (Da):84,632
Checksum:iBA3499B7CD6743BD
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QS64J3QS64_HUMAN
Transcription elongation factor SPT...
SUPT6H
50Annotation score:
K7EK85K7EK85_HUMAN
Transcription elongation factor SPT...
SUPT6H
53Annotation score:

Sequence cautioni

The sequence AAB18949 differs from that shown. Reason: Frameshift at position 988.Curated
The sequence AAC50821 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH33074 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA11479 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti61 – 73DDDED…EDEGS → ATAPGHPKLSEGR in AAC50821 (PubMed:8786132).CuratedAdd BLAST13
Sequence conflicti100 – 109DFDLIEENLG → LEDDDFLLNE in AAH33074 (PubMed:15489334).Curated10
Sequence conflicti988 – 994YVCGLGP → VCLWPGT in AAB18949 (PubMed:8786132).Curated7
Sequence conflicti1545L → P in AAH17105 (PubMed:15489334).Curated1
Sequence conflicti1627S → I in AAH17105 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0115051 – 1181Missing in isoform 2. 1 PublicationAdd BLAST1181
Alternative sequenceiVSP_011507617 – 1616Missing in isoform 3. 1 PublicationAdd BLAST1000
Alternative sequenceiVSP_0115061182 – 1211ESYDQ…PELSE → MPSRGTRPEDSSVLIPTDNS TPHKEDLSSK in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U38623 mRNA Translation: AAC99996.1
U38658 mRNA Translation: AAB18949.1 Frameshift.
U46691 mRNA Translation: AAC50821.1 Different initiation.
D79984 mRNA Translation: BAA11479.2 Different initiation.
CH471159 Genomic DNA Translation: EAW51117.1
BC003692 mRNA Translation: AAH03692.1
BC003696 mRNA Translation: AAH03696.1
BC017105 mRNA Translation: AAH17105.1
BC033074 mRNA Translation: AAH33074.1 Different initiation.
BC073963 mRNA Translation: AAH73963.1
BC136522 mRNA Translation: AAI36523.1
BC136524 mRNA Translation: AAI36525.1
BC150268 mRNA Translation: AAI50269.1
AF070532 mRNA Translation: AAC28631.1
CCDSiCCDS32596.1 [Q7KZ85-1]
RefSeqiNP_001307684.1, NM_001320755.1 [Q7KZ85-1]
NP_003161.2, NM_003170.4 [Q7KZ85-1]
XP_016880467.1, XM_017024978.1 [Q7KZ85-1]
XP_016880468.1, XM_017024979.1 [Q7KZ85-1]
XP_016880469.1, XM_017024980.1
UniGeneiHs.250429
Hs.735114

Genome annotation databases

EnsembliENST00000314616; ENSP00000319104; ENSG00000109111 [Q7KZ85-1]
ENST00000347486; ENSP00000338143; ENSG00000109111 [Q7KZ85-1]
GeneIDi6830
KEGGihsa:6830
UCSCiuc002hby.4 human [Q7KZ85-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U38623 mRNA Translation: AAC99996.1
U38658 mRNA Translation: AAB18949.1 Frameshift.
U46691 mRNA Translation: AAC50821.1 Different initiation.
D79984 mRNA Translation: BAA11479.2 Different initiation.
CH471159 Genomic DNA Translation: EAW51117.1
BC003692 mRNA Translation: AAH03692.1
BC003696 mRNA Translation: AAH03696.1
BC017105 mRNA Translation: AAH17105.1
BC033074 mRNA Translation: AAH33074.1 Different initiation.
BC073963 mRNA Translation: AAH73963.1
BC136522 mRNA Translation: AAI36523.1
BC136524 mRNA Translation: AAI36525.1
BC150268 mRNA Translation: AAI50269.1
AF070532 mRNA Translation: AAC28631.1
CCDSiCCDS32596.1 [Q7KZ85-1]
RefSeqiNP_001307684.1, NM_001320755.1 [Q7KZ85-1]
NP_003161.2, NM_003170.4 [Q7KZ85-1]
XP_016880467.1, XM_017024978.1 [Q7KZ85-1]
XP_016880468.1, XM_017024979.1 [Q7KZ85-1]
XP_016880469.1, XM_017024980.1
UniGeneiHs.250429
Hs.735114

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6GMEX-ray1.80A/B1338-1520[»]
6GMHelectron microscopy3.10M1-1726[»]
ProteinModelPortaliQ7KZ85
SMRiQ7KZ85
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112698, 87 interactors
CORUMiQ7KZ85
DIPiDIP-42615N
IntActiQ7KZ85, 31 interactors
MINTiQ7KZ85
STRINGi9606.ENSP00000319104

PTM databases

iPTMnetiQ7KZ85
PhosphoSitePlusiQ7KZ85

Polymorphism and mutation databases

BioMutaiSUPT6H
DMDMi51701986

Proteomic databases

EPDiQ7KZ85
MaxQBiQ7KZ85
PaxDbiQ7KZ85
PeptideAtlasiQ7KZ85
PRIDEiQ7KZ85
ProteomicsDBi68703
68704 [Q7KZ85-2]
68705 [Q7KZ85-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000314616; ENSP00000319104; ENSG00000109111 [Q7KZ85-1]
ENST00000347486; ENSP00000338143; ENSG00000109111 [Q7KZ85-1]
GeneIDi6830
KEGGihsa:6830
UCSCiuc002hby.4 human [Q7KZ85-1]

Organism-specific databases

CTDi6830
EuPathDBiHostDB:ENSG00000109111.14
GeneCardsiSUPT6H
HGNCiHGNC:11470 SUPT6H
HPAiCAB012416
HPA036382
MIMi601333 gene
neXtProtiNX_Q7KZ85
OpenTargetsiENSG00000109111
PharmGKBiPA36256
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1856 Eukaryota
COG2183 LUCA
GeneTreeiENSGT00510000047446
HOVERGENiHBG093994
InParanoidiQ7KZ85
KOiK11292
OMAiNTSPHSM
OrthoDBiEOG091G00SW
PhylomeDBiQ7KZ85
TreeFamiTF105956

Enzyme and pathway databases

ReactomeiR-HSA-112382 Formation of RNA Pol II elongation complex
R-HSA-674695 RNA Polymerase II Pre-transcription Events
R-HSA-75955 RNA Polymerase II Transcription Elongation
SignaLinkiQ7KZ85

Miscellaneous databases

ChiTaRSiSUPT6H human
GeneWikiiSUPT6H
GenomeRNAii6830
PMAP-CutDBiQ7KZ85
PROiPR:Q7KZ85
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000109111 Expressed in 224 organ(s), highest expression level in left lobe of thyroid gland
ExpressionAtlasiQ7KZ85 baseline and differential
GenevisibleiQ7KZ85 HS

Family and domain databases

CDDicd09928 SH2_Cterm_SPT6_like, 1 hit
cd09918 SH2_Nterm_SPT6_like, 1 hit
Gene3Di3.30.505.10, 2 hits
InterProiView protein in InterPro
IPR012340 NA-bd_OB-fold
IPR012337 RNaseH-like_sf
IPR010994 RuvA_2-like
IPR022967 S1_dom
IPR003029 S1_domain
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR028083 Spt6_acidic_N_dom
IPR027999 Spt6_dom
IPR032706 Spt6_HHH
IPR028088 Spt6_HTH_DNA-bd_dom
IPR035420 Spt6_SH2
IPR035018 Spt6_SH2_C
IPR035019 Spt6_SH2_N
IPR028231 Spt6_YqgF
IPR017072 TF_Spt6
IPR006641 YqgF/RNaseH-like_dom
PANTHERiPTHR10145 PTHR10145, 1 hit
PfamiView protein in Pfam
PF14878 DLD, 1 hit
PF14635 HHH_7, 1 hit
PF14641 HTH_44, 1 hit
PF00575 S1, 1 hit
PF14633 SH2_2, 1 hit
PF14632 SPT6_acidic, 1 hit
PF14639 YqgF, 1 hit
PIRSFiPIRSF036947 Spt6, 1 hit
SMARTiView protein in SMART
SM00316 S1, 1 hit
SM00252 SH2, 1 hit
SM00732 YqgFc, 1 hit
SUPFAMiSSF47781 SSF47781, 2 hits
SSF50249 SSF50249, 1 hit
SSF53098 SSF53098, 1 hit
SSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50126 S1, 1 hit
PS50001 SH2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSPT6H_HUMAN
AccessioniPrimary (citable) accession number: Q7KZ85
Secondary accession number(s): A7E2B4
, Q15737, Q6GMQ4, Q7KYW9, Q7LDK4, Q8N526, Q92775, Q96AH3, Q9BTH9, Q9BTI2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: November 7, 2018
This is version 152 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again