Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 138 (03 Jul 2019)
Sequence version 1 (03 Oct 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Transitional endoplasmic reticulum ATPase TER94

Gene

TER94

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process. Involved in the ubiquitin-proteasome system. Important for oskar mRNA localization and/or anchoring during oogenesis. Involved in germ cell formation.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei345ATP 1By similarity1
Binding sitei381ATP 1By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi244 – 250ATP 1By similarity7
Nucleotide bindingi518 – 523ATP 2By similarity6

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Hydrolase
Biological processDifferentiation, Oogenesis, Transport, Ubl conjugation pathway
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-110320 Translesion Synthesis by POLH
R-DME-3371511 HSF1 activation
R-DME-382556 ABC-family proteins mediated transport
R-DME-532668 N-glycan trimming in the ER and Calnexin/Calreticulin cycle
R-DME-5358346 Hedgehog ligand biogenesis
R-DME-5689896 Ovarian tumor domain proteases
R-DME-6798695 Neutrophil degranulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transitional endoplasmic reticulum ATPase TER94 (EC:3.6.4.6)
Alternative name(s):
Valosin-containing protein homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TER94
Synonyms:VCP
ORF Names:CG2331
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0261014 TER94

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi437E → A in ter94-26-8; arrests early in oogenesis. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003471781 – 801Transitional endoplasmic reticulum ATPase TER94Add BLAST801

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei716Phosphoserine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7KN62

PRoteomics IDEntifications database

More...
PRIDEi
Q7KN62

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7KN62

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Present in the mushroom bodies of the protocerebrum and in the glomeruli of the antennal lobe. Present in nurse cells, oocytes and sperm bundles (at protein level).3 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Present in egg, pupa and imago but not larva (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0261014 Expressed in 48 organ(s), highest expression level in imaginal disc

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7KN62 differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7KN62 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homohexamer (PubMed:10564274).

Interacts with tud, vas, papi and AGO3 (PubMed:18590813, PubMed:21447556).

Interacts with Npl4 (PubMed:26471729).

4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
61868, 108 interactors

Database of interacting proteins

More...
DIPi
DIP-52184N

Protein interaction database and analysis system

More...
IntActi
Q7KN62, 10 interactors

Molecular INTeraction database

More...
MINTi
Q7KN62

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0111818

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1801
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7KN62

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the AAA ATPase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0730 Eukaryota
COG0464 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00900000141071

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7KN62

KEGG Orthology (KO)

More...
KOi
K13525

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7KN62

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003593 AAA+_ATPase
IPR005938 AAA_ATPase_CDC48
IPR041569 AAA_lid_3
IPR009010 Asp_de-COase-like_dom_sf
IPR003959 ATPase_AAA_core
IPR003960 ATPase_AAA_CS
IPR004201 Cdc48_dom2
IPR029067 CDC48_domain_2-like_sf
IPR003338 CDC4_N-term_subdom
IPR027417 P-loop_NTPase
IPR015415 Vps4_C

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00004 AAA, 2 hits
PF17862 AAA_lid_3, 2 hits
PF02933 CDC48_2, 1 hit
PF02359 CDC48_N, 1 hit
PF09336 Vps4_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00382 AAA, 2 hits
SM01072 CDC48_2, 1 hit
SM01073 CDC48_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50692 SSF50692, 1 hit
SSF52540 SSF52540, 2 hits
SSF54585 SSF54585, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01243 CDC48, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00674 AAA, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform A (identifier: Q7KN62-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADSKGEDLA TAILKRKDRP NRLIVEEAQN DDNSVVSLSQ AKMDELQLFR
60 70 80 90 100
GDTVILKGKR RKETVCIVLS DDTCPDEKIR MNRVVRNNLC VHLSDVVSVQ
110 120 130 140 150
SCPDVKYGKR VRILPIDEST EGVTGNLFEI YLKPYFLEAY RPIHMGDNFI
160 170 180 190 200
VRAAMRPIEF KVVLTDPEPY CIVAPETVIF CDGDPIKREE EEESLNAVGY
210 220 230 240 250
DDIGGCRKQL AQIKEMVELP LRHPSLFKAI GVKPPRGILM YGPPGTGKTL
260 270 280 290 300
IARAVANETG AFFFLINGPE IMSKLAGESE SNLRKAFEEA EKNSPAIIFI
310 320 330 340 350
DEIDAIAPKR DKTHGEVERR IVSQLLTLMD GMKKSSHLIV MAATNRPNSI
360 370 380 390 400
DPALRRFGRF DREIDIGIPD ATGRLEVLRI HTKNMKLHDD VDLEQIAAES
410 420 430 440 450
HGHVGADLAS LCSEAALQQI REKMDLIDLE DDKIDAEVLA SLAVTMENFR
460 470 480 490 500
YAMTKSSPSA LRETVVEVPN TTWTDIGGLE SVKKELQELV QYPVEHPDKF
510 520 530 540 550
LKFGMQPSRG VLFYGPPGCG KTLLAKAIAN ECQANFISVK GPELLTMWFG
560 570 580 590 600
ESEANVRDIF DKARSAAPCV LFFDELDSIA KARGGNVGDA GGAADRVINQ
610 620 630 640 650
ILTEMDGMGA KKNVFIIGAT NRPDIIDPAI LRPGRLDQLI YIPLPDDKSR
660 670 680 690 700
EAILKANLRK SPLAKEVDLT YIAKVTQGFS GADLTEICQR ACKLAIRQAI
710 720 730 740 750
EAEIRREKER AENQNSAMDM DEDDPVPEIT SAHFEEAMKF ARRSVSDNDI
760 770 780 790 800
RKYEMFAQTL QQSRGFGQNF RFPGQTGNTS GSGNNLPVNS PGDNGDDDLY

S
Length:801
Mass (Da):88,859
Last modified:October 3, 2006 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iECF8F173B3B10B07
GO
Isoform D (identifier: Q7KN62-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: Missing.

Note: No experimental confirmation available.
Show »
Length:759
Mass (Da):84,250
Checksum:i3C3B83366776697E
GO
Isoform C (identifier: Q7KN62-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MADSKG → MDHDGDTRDFMRGYHSEQDEKMKPKDSFDKR

Note: No experimental confirmation available.
Show »
Length:826
Mass (Da):92,055
Checksum:iB6D5F85ECE7BCA33
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4LFZ4A0A0B4LFZ4_DROME
TER94, isoform E
TER94 22.26, 7.12, anon-WO2004063362.65, anon-WO2004063362.67, Apple
825Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF17568 differs from that shown. Reason: Frameshift at positions 136, 142, 757 and 761.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti524L → P in AAF17568 (PubMed:10656772).Curated1
Sequence conflicti563 – 564AR → GP in AAF17568 (PubMed:10656772).Curated2
Sequence conflicti582 – 584ARG → SRC in AAF17568 (PubMed:10656772).Curated3
Sequence conflicti590 – 591AG → C in AAF17568 (PubMed:10656772).Curated2
Sequence conflicti661 – 662SP → FA in AAF17568 (PubMed:10656772).Curated2
Sequence conflicti662P → A in AAC27447 (PubMed:9639875).Curated1
Sequence conflicti720Missing in AAF17568 (PubMed:10656772).Curated1
Sequence conflicti735E → Q in AAC27447 (PubMed:9639875).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0350521 – 42Missing in isoform D. CuratedAdd BLAST42
Alternative sequenceiVSP_0350531 – 6MADSKG → MDHDGDTRDFMRGYHSEQDE KMKPKDSFDKR in isoform C. Curated6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF047037 mRNA Translation: AAC27447.1
AF202034 mRNA Translation: AAF17568.1 Frameshift.
AE013599 Genomic DNA Translation: ABV53745.1
AE013599 Genomic DNA Translation: ABV53746.1
AE013599 Genomic DNA Translation: AAF58863.1
AF132553 mRNA Translation: AAD27852.1

NCBI Reference Sequences

More...
RefSeqi
NP_001097249.1, NM_001103779.2 [Q7KN62-3]
NP_001097250.1, NM_001103780.2 [Q7KN62-2]
NP_477369.1, NM_058021.4 [Q7KN62-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0088391; FBpp0087479; FBgn0261014 [Q7KN62-1]
FBtr0112905; FBpp0111818; FBgn0261014 [Q7KN62-3]
FBtr0112906; FBpp0111819; FBgn0261014 [Q7KN62-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
36040

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG2331

UCSC genome browser

More...
UCSCi
CG2331-RA d. melanogaster [Q7KN62-1]
CG2331-RC d. melanogaster
CG2331-RD d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF047037 mRNA Translation: AAC27447.1
AF202034 mRNA Translation: AAF17568.1 Frameshift.
AE013599 Genomic DNA Translation: ABV53745.1
AE013599 Genomic DNA Translation: ABV53746.1
AE013599 Genomic DNA Translation: AAF58863.1
AF132553 mRNA Translation: AAD27852.1
RefSeqiNP_001097249.1, NM_001103779.2 [Q7KN62-3]
NP_001097250.1, NM_001103780.2 [Q7KN62-2]
NP_477369.1, NM_058021.4 [Q7KN62-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4RV0X-ray2.00A/C/E/G20-186[»]
SMRiQ7KN62
ModBaseiSearch...

Protein-protein interaction databases

BioGridi61868, 108 interactors
DIPiDIP-52184N
IntActiQ7KN62, 10 interactors
MINTiQ7KN62
STRINGi7227.FBpp0111818

PTM databases

iPTMnetiQ7KN62

Proteomic databases

PaxDbiQ7KN62
PRIDEiQ7KN62

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0088391; FBpp0087479; FBgn0261014 [Q7KN62-1]
FBtr0112905; FBpp0111818; FBgn0261014 [Q7KN62-3]
FBtr0112906; FBpp0111819; FBgn0261014 [Q7KN62-2]
GeneIDi36040
KEGGidme:Dmel_CG2331
UCSCiCG2331-RA d. melanogaster [Q7KN62-1]
CG2331-RC d. melanogaster
CG2331-RD d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
36040
FlyBaseiFBgn0261014 TER94

Phylogenomic databases

eggNOGiKOG0730 Eukaryota
COG0464 LUCA
GeneTreeiENSGT00900000141071
InParanoidiQ7KN62
KOiK13525
PhylomeDBiQ7KN62

Enzyme and pathway databases

ReactomeiR-DME-110320 Translesion Synthesis by POLH
R-DME-3371511 HSF1 activation
R-DME-382556 ABC-family proteins mediated transport
R-DME-532668 N-glycan trimming in the ER and Calnexin/Calreticulin cycle
R-DME-5358346 Hedgehog ligand biogenesis
R-DME-5689896 Ovarian tumor domain proteases
R-DME-6798695 Neutrophil degranulation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TER94 fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
36040

Protein Ontology

More...
PROi
PR:Q7KN62

Gene expression databases

BgeeiFBgn0261014 Expressed in 48 organ(s), highest expression level in imaginal disc
ExpressionAtlasiQ7KN62 differential
GenevisibleiQ7KN62 DM

Family and domain databases

InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR005938 AAA_ATPase_CDC48
IPR041569 AAA_lid_3
IPR009010 Asp_de-COase-like_dom_sf
IPR003959 ATPase_AAA_core
IPR003960 ATPase_AAA_CS
IPR004201 Cdc48_dom2
IPR029067 CDC48_domain_2-like_sf
IPR003338 CDC4_N-term_subdom
IPR027417 P-loop_NTPase
IPR015415 Vps4_C
PfamiView protein in Pfam
PF00004 AAA, 2 hits
PF17862 AAA_lid_3, 2 hits
PF02933 CDC48_2, 1 hit
PF02359 CDC48_N, 1 hit
PF09336 Vps4_C, 1 hit
SMARTiView protein in SMART
SM00382 AAA, 2 hits
SM01072 CDC48_2, 1 hit
SM01073 CDC48_N, 1 hit
SUPFAMiSSF50692 SSF50692, 1 hit
SSF52540 SSF52540, 2 hits
SSF54585 SSF54585, 1 hit
TIGRFAMsiTIGR01243 CDC48, 1 hit
PROSITEiView protein in PROSITE
PS00674 AAA, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTERA_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7KN62
Secondary accession number(s): A8DY85
, A8DY86, O76279, Q9U463
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: October 3, 2006
Last modified: July 3, 2019
This is version 138 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again